ATAT1 Antibody

Images

 
Western Blot: ATAT1 Antibody [NBP1-57690] - HepG2 cell lysate, concentration 2.5 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ATAT1 Antibody Summary

Immunogen
Synthetic peptides corresponding to ATAT1. The peptide sequence was selected from the N terminal of ATAT1 (NP_079185). Peptide sequence MEFPFDVDALFPERITVLDQHLRPPARRPGTTTPARVDLQQQIMTIIDEL.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATAT1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 2.5 ug/ml
Theoretical MW
36 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ATAT1 Antibody

  • Acetyltransferase MEC-17
  • alpha tubulin acetyltransferase 1
  • alpha-TAT
  • alpha-tubulin N-acetyltransferase
  • C6orf134
  • chromosome 6 open reading frame 134
  • DKFZp547J097
  • EC 2.3.1.108
  • Em:AB023049.7
  • FLJ13158
  • MEC17Nbla00487
  • TAT

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1267
Species: Hu
Applications: WB, IP, Neut
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88376
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-19773
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-20648
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NB600-930
Species: Hu, Ba
Applications: WB, ELISA
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-07799
Species: Hu
H00000904-Q01
Species: Hu
NB120-10874
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-15139
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P

Publications for ATAT1 Antibody (NBP1-57690) (0)

There are no publications for ATAT1 Antibody (NBP1-57690).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATAT1 Antibody (NBP1-57690) (0)

There are no reviews for ATAT1 Antibody (NBP1-57690). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ATAT1 Antibody (NBP1-57690) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATAT1 Products

Bioinformatics Tool for ATAT1 Antibody (NBP1-57690)

Discover related pathways, diseases and genes to ATAT1 Antibody (NBP1-57690). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ATAT1

There are no specific blogs for ATAT1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATAT1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATAT1
Entrez
Uniprot