TAT Antibody

Images

 
Western Blot: TAT Antibody [NBP1-79286] - Rat Brain Lysate 1.0 ug/ml, gel concentration 12%

Product Details

Summary
Reactivity RtSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TAT Antibody Summary

Immunogen
The immunogen for this antibody is Tat. Peptide sequence PGLQPVRPSGAMYLMVGIEMEHFPEFENDVEFTERLIAEQAVHCLPATCF. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TAT
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against Tat and was validated on Western blot.
Reviewed Applications
Read 1 Review rated 3
using
NBP1-79286 in the following application:

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TAT Antibody

  • EC 2.6.1.5
  • L-tyrosine:2-oxoglutarate aminotransferase
  • tyrosine aminotransferase
  • tyrosine aminotransferase, cytosolic

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-76966
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-58268
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-88376
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
DSE100
Species: Hu
Applications: ELISA
NB600-930
Species: Hu, Rt
Applications: ELISA, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP3-05509
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67811
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
D6050
Species: Hu
Applications: ELISA
NBP2-58917
Species: Hu
Applications: IHC, IHC-P, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP1-79286
Species: Rt
Applications: WB

Publications for TAT Antibody (NBP1-79286) (0)

There are no publications for TAT Antibody (NBP1-79286).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for TAT Antibody (NBP1-79286) (1) 31

Average Rating: 3
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-79286:
Filter by Applications
Western Blot
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
  3
reviewed by:
Chenicka Mangahas
Western Blot Human 06/20/2017
View

Summary

ApplicationWestern Blot
Sample TestediPSC
SpeciesHuman
LotQC20355-40764

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TAT Antibody (NBP1-79286) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TAT Products

Array NBP1-79286

Bioinformatics Tool for TAT Antibody (NBP1-79286)

Discover related pathways, diseases and genes to TAT Antibody (NBP1-79286). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TAT Antibody (NBP1-79286)

Discover more about diseases related to TAT Antibody (NBP1-79286).
 

Pathways for TAT Antibody (NBP1-79286)

View related products by pathway.

PTMs for TAT Antibody (NBP1-79286)

Learn more about PTMs related to TAT Antibody (NBP1-79286).
 

Research Areas for TAT Antibody (NBP1-79286)

Find related products by research area.

Blogs on TAT.

Methamphetamine with HIV induces mitochondrial dysfunction and neuronal injury through oxidative stress
By Jamshed Arslan, Pharm. D., PhD. December 1 is the World AIDS Day. Despite the combination antiretroviral therapy, 10-25% of Human Immunodeficiency Virus (HIV)-positive individuals report neurocognitive impairm...  Read full blog post.

Understanding Transcription with RNA Polymerase II
RNA polymerase II is a large 12-subunit complex that synthesizes all mRNAs and several non-coding RNAs in eukaryotic cells. It is a DNA-dependent RNA polymerase enzyme that catalyzes transcription of DNA into RNA based on the four ribonucleoside triph...  Read full blog post.

Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

3
5
0
4
0
3
1
2
0
1
0

 
Chenicka Mangahas
06/20/2017
Application: Western Blot
Species: Human

Bioinformatics

Gene Symbol TAT
Uniprot