SLC22A8 Antibody

Immunohistochemistry-Paraffin: SLC22A8 Antibody [NBP1-92396] - Analysis in human kidney and tonsil tissues using NBP1-92396 antibody. Corresponding SLC22A8 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: SLC22A8 Antibody [NBP1-92396] - Staining of human tonsil shows no positivity in non-germinal center cells as expected.

Immunohistochemistry-Paraffin: SLC22A8 Antibody [NBP1-92396] - Staining of human kidney shows moderate positivity in baslolateral membrane cells in tubules.

Immunohistochemistry-Paraffin: SLC22A8 Antibody [NBP1-92396] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: SLC22A8 Antibody [NBP1-92396] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

• Reactivity: Hu
• Applications: IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

SLC22A8 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KKEEGERLSLEELKLNLQKEISLAKAKYTASDLFRIPMLR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC22A8
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  SLC22A8 Protein (NBP1-92396PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SLC22A8 Antibody

• hOAT3
• MGC24086
• OAT3Organic anion transporter 3
• solute carrier family 22 (organic anion transporter), member 8
• solute carrier family 22 member 8

Background

SLC22A8 is encoded by this gene is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC22A8