SLC22A7 Antibody Summary
Immunogen |
Synthetic peptides corresponding to SLC22A7(solute carrier family 22 (organic anion transporter), member 7) The peptide sequence was selected from the N terminal of SLC22A7.
Peptide sequence LPGAPANFSHQDVWLEAHLPREPDGTLSSCLRFAYPQALPNTTLGEER The peptide sequence for this immunogen was taken from within the described region. |
Predicted Species |
Equine (100%), Bovine (92%), Guinea Pig (93%). Backed by our 100% Guarantee. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
SLC22A7 |
Purity |
Protein A purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Western Blot 1:100-1:2000
- Immunohistochemistry 1:10-1:500
- Immunohistochemistry-Paraffin 1:10-1:500
|
Theoretical MW |
60 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS and 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Purity |
Protein A purified |
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for SLC22A7 Antibody
Background
SLC22A7 is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The protein is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney.The protein encoded by this gene is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney. Alternatively spliced transcript variants encoding different isoforms have been described.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
Species: Hu, Rt
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
Species: Hu, Mu
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Bv
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Rt
Applications: WB, IHC, IHC-P, Single-Cell Western
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IP, CyTOF-ready, Dual ISH-IHC
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Bv, Eq, Gp
Applications: WB, IHC, IHC-P
Publications for SLC22A7 Antibody (NBP1-62660) (0)
There are no publications for SLC22A7 Antibody (NBP1-62660).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SLC22A7 Antibody (NBP1-62660) (0)
There are no reviews for SLC22A7 Antibody (NBP1-62660).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for SLC22A7 Antibody (NBP1-62660) (0)
Secondary Antibodies
| |
Isotype Controls
|
Other Available Formats
Additional SLC22A7 Products
Bioinformatics Tool for SLC22A7 Antibody (NBP1-62660)
Discover related pathways, diseases and genes to SLC22A7 Antibody (NBP1-62660). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for SLC22A7 Antibody (NBP1-62660)
Discover more about diseases related to SLC22A7 Antibody (NBP1-62660).
| | Pathways for SLC22A7 Antibody (NBP1-62660)
View related products by pathway.
|
PTMs for SLC22A7 Antibody (NBP1-62660)
Learn more about PTMs related to SLC22A7 Antibody (NBP1-62660).
|
Blogs on SLC22A7