SLC22A7 Antibody


Western Blot: SLC22A7 Antibody [NBP1-62660] - Sample Tissue: Jurkat, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 2.5ug/mL, Peptide Concentration: 2.0ug/mL, more
Immunohistochemistry-Paraffin: SLC22A7 Antibody [NBP1-62660] - Human Muscle Tissue, Skeletal muscle cells (Indicated with Arrows) 4-8ug/ml.
Western Blot: SLC22A7 Antibody [NBP1-62660] - Titration: 5.0ug/ml Positive Control: Jurkat cell lysate.

Product Details

Reactivity Hu, Bv, Eq, GpSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

SLC22A7 Antibody Summary

Synthetic peptides corresponding to SLC22A7(solute carrier family 22 (organic anion transporter), member 7) The peptide sequence was selected from the N terminal of SLC22A7. Peptide sequence LPGAPANFSHQDVWLEAHLPREPDGTLSSCLRFAYPQALPNTTLGEER The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Equine (100%), Bovine (92%), Guinea Pig (93%). Backed by our 100% Guarantee.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Theoretical MW
60 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SLC22A7 Antibody

  • hOAT2
  • liver-specific transporter
  • NLTMGC45202
  • Novel liver transporter
  • OAT2MGC24091
  • Organic anion transporter 2
  • solute carrier family 22 (organic anion transporter), member 7
  • solute carrier family 22 member 7


SLC22A7 is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The protein is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney.The protein encoded by this gene is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney. Alternatively spliced transcript variants encoding different isoforms have been described.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
Species: Hu, Rt
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
Species: Hu, Mu
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Bv
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Rt
Applications: WB, IHC, IHC-P, Single-Cell Western
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IP, CyTOF-ready, Dual ISH-IHC
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Bv, Eq, Gp
Applications: WB, IHC, IHC-P

Publications for SLC22A7 Antibody (NBP1-62660) (0)

There are no publications for SLC22A7 Antibody (NBP1-62660).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC22A7 Antibody (NBP1-62660) (0)

There are no reviews for SLC22A7 Antibody (NBP1-62660). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC22A7 Antibody (NBP1-62660) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional SLC22A7 Products

Bioinformatics Tool for SLC22A7 Antibody (NBP1-62660)

Discover related pathways, diseases and genes to SLC22A7 Antibody (NBP1-62660). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC22A7 Antibody (NBP1-62660)

Discover more about diseases related to SLC22A7 Antibody (NBP1-62660).

Pathways for SLC22A7 Antibody (NBP1-62660)

View related products by pathway.

PTMs for SLC22A7 Antibody (NBP1-62660)

Learn more about PTMs related to SLC22A7 Antibody (NBP1-62660).

Blogs on SLC22A7

There are no specific blogs for SLC22A7, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SLC22A7 Antibody and receive a gift card or discount.


Gene Symbol SLC22A7