SLC22A7 Antibody

Western Blot: SLC22A7 Antibody [NBP1-62660] - Sample Tissue: Jurkat, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 2.5ug/mL, Peptide Concentration: 2.0ug/mL, Lysate Quantity: 25ug/lane, Gel Concentration: 12%

Immunohistochemistry-Paraffin: SLC22A7 Antibody [NBP1-62660] - Human Muscle Tissue, Skeletal muscle cells (Indicated with Arrows) 4-8ug/ml.

Western Blot: SLC22A7 Antibody [NBP1-62660] - Titration: 5.0ug/ml Positive Control: Jurkat cell lysate.

• Reactivity: Hu, Bv, Eq, Gp
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

SLC22A7 Antibody Summary

• Immunogen: Synthetic peptides corresponding to SLC22A7(solute carrier family 22 (organic anion transporter), member 7) The peptide sequence was selected from the N terminal of SLC22A7. Peptide sequence LPGAPANFSHQDVWLEAHLPREPDGTLSSCLRFAYPQALPNTTLGEER The peptide sequence for this immunogen was taken from within the described region.
• Predicted Species: Equine (100%), Bovine (92%), Guinea Pig (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC22A7
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
• Theoretical MW: 60 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SLC22A7 Antibody

• hOAT2
• liver-specific transporter
• NLTMGC45202
• Novel liver transporter
• OAT2MGC24091
• Organic anion transporter 2
• solute carrier family 22 (organic anion transporter), member 7
• solute carrier family 22 member 7

Background

SLC22A7 is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The protein is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney.The protein encoded by this gene is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney. Alternatively spliced transcript variants encoding different isoforms have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC22A7
• Uniprot:
  • Q5T048(Human)