SLC22A7 Antibody

Images

 
Western Blot: SLC22A7 Antibody [NBP1-62660] - Sample Tissue: Jurkat, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 2.5ug/mL, Peptide Concentration: 2.0ug/mL, ...read more
Immunohistochemistry-Paraffin: SLC22A7 Antibody [NBP1-62660] - Human Muscle Tissue, Skeletal muscle cells (Indicated with Arrows) 4-8ug/ml.
Western Blot: SLC22A7 Antibody [NBP1-62660] - Titration: 5.0ug/ml Positive Control: Jurkat cell lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC22A7 Antibody Summary

Immunogen
Synthetic peptides corresponding to SLC22A7(solute carrier family 22 (organic anion transporter), member 7) The peptide sequence was selected from the N terminal of SLC22A7. Peptide sequence LPGAPANFSHQDVWLEAHLPREPDGTLSSCLRFAYPQALPNTTLGEER
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC22A7
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Theoretical MW
60 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SLC22A7 Antibody

  • hOAT2
  • liver-specific transporter
  • NLTMGC45202
  • Novel liver transporter
  • OAT2MGC24091
  • Organic anion transporter 2
  • solute carrier family 22 (organic anion transporter), member 7
  • solute carrier family 22 member 7

Background

SLC22A7 is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The protein is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney.The protein encoded by this gene is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney. Alternatively spliced transcript variants encoding different isoforms have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-62690
Species: Hu
Applications: IHC, IHC-P
NBP1-92396
Species: Hu
Applications: IHC, IHC-P
NBP2-42202
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-51684
Species: Hu, Mu
Applications: WB, EM, ELISA, Flow, IHC
NBP1-69536
Species: Hu
Applications: WB
H00114571-Q01
Species: Hu
NB100-74482
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-66958
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-83239
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-22124
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-59658
Species: Hu
Applications: WB
NBP1-89417
Species: Hu, Rt
Applications: WB, IHC, IHC-P, Single Cell Western
NBP2-21584
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-37923
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-76670
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
NBP1-31824
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-60109
Species: Hu
Applications: WB
NBP2-65352
Species: Hu
NBP1-62660
Species: Hu
Applications: WB, IHC, IHC-P

Publications for SLC22A7 Antibody (NBP1-62660) (0)

There are no publications for SLC22A7 Antibody (NBP1-62660).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC22A7 Antibody (NBP1-62660) (0)

There are no reviews for SLC22A7 Antibody (NBP1-62660). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC22A7 Antibody (NBP1-62660) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for SLC22A7 Antibody (NBP1-62660)

Discover related pathways, diseases and genes to SLC22A7 Antibody (NBP1-62660). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC22A7 Antibody (NBP1-62660)

Discover more about diseases related to SLC22A7 Antibody (NBP1-62660).
 

Pathways for SLC22A7 Antibody (NBP1-62660)

View related products by pathway.

PTMs for SLC22A7 Antibody (NBP1-62660)

Learn more about PTMs related to SLC22A7 Antibody (NBP1-62660).

Blogs on SLC22A7

There are no specific blogs for SLC22A7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC22A7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC22A7
Uniprot