Home » OAT » OAT Antibodies » OAT Antibody

OAT Antibody

 (2 Reviews)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: OAT Antibody [NBP1-83239] - Analysis in human duodenum and pancreas tissues. Corresponding OAT RNA-seq data are presented for the same tissues.
Orthogonal Strategies: Immunohistochemistry-Paraffin: OAT Antibody [NBP1-83239] - Analysis in human duodenum and pancreas tissues. Corresponding OAT RNA-seq data are presented for the same tissues.
Western Blot: OAT Antibody [NBP1-83239] - Analysis in control (vector only transfected HEK293T lysate) and OAT over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: OAT Antibody [NBP1-83239] - Staining of human duodenum shows strong granular cytoplasmic postivity in glandular cells.
Immunohistochemistry-Paraffin: OAT Antibody [NBP1-83239] - Staining of human cerebral cortex shows moderate to strong granular cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: OAT Antibody [NBP1-83239] - Staining of human testis shows moderate granular cytoplasmic positivity in Leydig cells.
Immunohistochemistry-Paraffin: OAT Antibody [NBP1-83239] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Product Details

Summary
Reactivity Hu, Bv, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

OAT Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ALKSQVDKLTLTSRAFYNNVLGEYEEYITKLFNYHKVLPMNTGVEAGETACKLARKWGYTVKGIQKYKAKIVFAAGNFWGRTLSAISSSTDPTSYDGFGPFMPGFDIIPYNDLPALERALQDPNVAAFMVEPIQGEAGV
Predicted Species
Mouse (96%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
OAT
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04 - 0.4 ug/mL
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
OAT Recombinant Protein Antigen (NBP1-83239PEP)
Reviewed Applications
Read 2 Reviews rated 5
using
NBP1-83239 in the following applications:

Reactivity Notes

Bovine reactivity reported from a verified customer review.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for OAT Antibody

  • GACR
  • HOGA
  • OAT ornithine aminotransferase
  • OATASE
  • OKT

Background

OAT, also known as mitochondrial enzyme ornithine aminotransferase, is a key enzyme in the pathway that converts arginine and ornithine into the major excitatory and inhibitory neurotransmitters glutamate and GABA. ( L-ornithine + a 2-oxo acid = L-glutamate 5-semialdehyde + an L-amino acid.) Mutations that result in a deficiency of this enzyme cause the autosomal recessive eye disease Gyrate Atrophy. Recombinant OAT protein was expressed in E.coli and purified by using conventional chromatography techniques.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Ornithine
Decarboxylase Antibod ...
NBP2-32887
Immunohistochemistry-Paraffin: Ornithine Decarboxylase Antibody (ODC1/485) [NBP2-32887] - Formalin-fixed, paraffin-embedded Mouse Pancreas stained with Ornithine Decarboxylase Antibody (ODC1/485).
Immunocytochemistry/Immunofluorescence: Ornithine Decarboxylase Antibody (ODC1/485) [NBP2-32887] - IF staining of LNCap cells using AF488 labeled ODC1 Monoclonal Antibody (ODC1/485) (GREEN) DAPI was used to stain the cell nucleus (blue). Image using the Azide and BSA Free format of this antibody.
Western Blot: Ornithine Decarboxylase Antibody (ODC1/485) [NBP2-32887] - Analysis using the Azide and BSA Free version of NBP2-32887. Detection of ODC1 in human placental lysate
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
SLC22A6 Antibody
NBP2-62690
Immunohistochemistry-Paraffin: SLC22A6 Antibody [NBP2-62690] - Analysis in human kidney and lymph node tissues using Anti-SLC22A6 antibody. Corresponding SLC22A6 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: SLC22A6 Antibody [NBP2-62690] - Staining of human lymph node shows low expression as expected.
Immunohistochemistry-Paraffin: SLC22A6 Antibody [NBP2-62690] - Staining of human kidney shows high expression.
Species: Hu
Applications: IHC, IHC-P
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Insulin was detected in immersion fixed beta TC‑6 mouse beta cell insulinoma cell line using Human/Mouse/Bovine Insulin Monoclonal Antibody (Catalog # MAB1417) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rat IgG Secondary Antibody (red; Catalog # NL013) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(16 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Coagulation Factor
II/Thrombin Antibody
NBP1-58268
Immunohistochemistry-Paraffin: Coagulation Factor II/Thrombin Antibody [NBP1-58268] - Human Placenta Tissue
Immunohistochemistry-Paraffin: Coagulation Factor II/Thrombin Antibody [NBP1-58268] - Human Placenta Tissue, 5.0ug/ml.
Western Blot: Coagulation Factor II/Thrombin Antibody [NBP1-58268] - 721_B tissue lysate at a concentration of 1ug/ml.
(1 Review)
(3 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Glutamine
Synthetase Antibody
NB110-41404
Immunocytochemistry/Immunofluorescence: Glutamine Synthetase Antibody [NB110-41404] - Immunofluorescence using NB110-41404. Submitted via verified customer review.
Western Blot: Glutamine Synthetase Antibody [NB110-41404] - Analysis of glutamine synthase. 40ug of lysates from mouse (Lanes M), rat (Lane R), pig (Lane P), bovine (Lane B), or human (Lane Hu) retina were probed. A 42 kDa band was identified in lysates from retinas of all species.
Immunohistochemistry: Glutamine Synthetase Antibody [NB110-41404] - Localization of glutamine synthase in the retina. Paraffin sections of mouse (A, B), rat (C, D, G-I), or human (E, F) retina fixed in 4% paraformaldehyde were reacted with anti-glutamine synthase (red fluorescence staining in B, D, G, I, and brown immuno-peroxidase reaction. Nuclei in IF experiments (A-D) were stained with DAPI (cyan), and with nuclear fast red in E and F. At low magnification, anti-glutamine synthase reacted with a single population of cells extending from the ganglion cell layer through the inner nuclear layer. No signal was detected in controls either pre-incubated with 100ug/ml of the immunizing peptide (A) or with pre-immune serum (C, E). This finding was confirmed by co-localization (indicated by yellow in I) of glutamine synthase (red in G) with antoher marker of glutamine synthase (green in H).
(1 Review)
(6 Publications)
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
LIGHT/TNFSF14
[Unconjugated]
664-LI/CF
1 µg/lane of Recombinant Human LIGHT/TNFSF14 (Catalog # 664-LI/CF) was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a band at 25 kDa.
Recombinant Human LIGHT/TNFSF14 (Catalog # 664-LI/CF) stimulates cell proliferation in HUVEC human umbilical vein endothelial cells. The ED50 is 1-4 ng/mL.
(18 Publications)
Species: Hu
Applications: BA
SLC22A8 Antibody
NBP1-92396
Immunohistochemistry-Paraffin: SLC22A8 Antibody [NBP1-92396] - Analysis in human kidney and tonsil tissues using NBP1-92396 antibody. Corresponding SLC22A8 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: SLC22A8 Antibody [NBP1-92396] - Staining of human kidney shows moderate positivity in baslolateral membrane cells in tubules.
Immunohistochemistry-Paraffin: SLC22A8 Antibody [NBP1-92396] - Staining of human liver shows no positivity in hepatocytes as expected.
Species: Hu
Applications: IHC, IHC-P
Glutaminyl-peptide
Cyclotransferase/QPCT ...
NBP1-81838
Western Blot: Glutaminyl-peptide Cyclotransferase/QPCT Antibody [NBP1-81838] - Analysis in human cell line SK-MEL-30.
Immunohistochemistry: Glutaminyl-peptide Cyclotransferase/QPCT Antibody [NBP1-81838] - Staining of human adrenal gland shows high expression.
Immunohistochemistry-Paraffin: Glutaminyl-peptide Cyclotransferase/QPCT Antibody [NBP1-81838] - Staining of human liver shows low expression as expected.
(1 Publication)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
AGA Antibody
NBP1-88866
Immunohistochemistry-Paraffin: AGA Antibody [NBP1-88866] - Staining of human epididymis shows high expression.
Immunohistochemistry-Paraffin: AGA Antibody [NBP1-88866] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: AGA Antibody [NBP1-88866] - Staining in human epididymis and skeletal muscle tissues using anti-AGA antibody. Corresponding AGA RNA-seq data are presented for the same tissues.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P
GLS2 Antibody -
BSA Free
NBP1-76544
Western Blot: GLS2 Antibody [NBP1-76544] - Glutaminase protein expression in PC3 and PC3M cell lines before/after CB-839 treatment. PC3 & PC3M cells were treated (+) or not treated (-) with GLS1 inhibitor CB-839 (1 uM) and their expression of GLS1 & GLS2 proteins determined by Western blot. Antibodies specific for GAC & KCA were utilized on two replicate samples, while GLS2 expression was determined on three. PC3 cell lysates expressed GLS2 more than PC3M cell lysates regardless of CB-839 treatment. The difference in GLS2 expression was significant in the untreated cells (P?<?0.03) but because of high variability the difference was not significant in the drug-treated cells. Levels of GLS1 (GAC and KGA) were similar in all cell lysates. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41598-017-16327-z), licensed under a CC-BY licence.
Immunohistochemistry: GLS2 Antibody [NBP1-76544] - Immunohistochemistry of GLS2 in human kidney tissue with GLS2 antibody at 5 ug/mL.
Immunocytochemistry/Immunofluorescence: GLS2 Antibody [NBP1-76544] - of GLS2 in Human Kidney cells. Dilution 20 ug/mL.
(5 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, Simple Western, WB
Catalase Antibody
[Unconjugated]
AF3398
Western blot shows lysates of Jurkat human acute T cell leukemia cell line, Raji human Burkitt's lymphoma cell line, HeLa human cervical epithelial carcinoma cell line, NIH‑3T3 mouse embryonic fibroblast cell line, A20 mouse B cell lymphoma cell line, andRat‑2 rat embryonic fibroblast cell line. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF3398) followed by HRP-conjugated Anti‑Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for Catalase at approximately 64 kDa (as indicated). This experiment was conducted using Immunoblot Buffer Group 2. 
Simple Western lane view shows lysates of Jurkat human acute T cell leukemia cell line and Raji human Burkitt's lymphoma cell line, loaded at 0.2 mg/mL. A specific band was detected for Catalase at approximately 62 kDa (as indicated) using 5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3398) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and Catalase knockout HeLa cell line (KO). PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3398) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Catalase at approximately 64 kDa (as indicated) in the parental HeLa cell line, but is not detectable in knockout HeLa cell line. GAPDH (Catalog # AF5718) is shown as a loading control. This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(3 Reviews)
(6 Publications)
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
DMPK Antibody
(713931)
MAB6967
Western blot shows lysates of human heart tissue. PVDF membrane was probed with 2 µg/mL of Mouse Anti-Human DMPK Monoclonal Antibody (Catalog # MAB6967) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for DMPK at approximately 74 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu
Applications: WB
Neurophysin
II/Arg-vasopressin An ...
AF009
Neurophysin II was detected in immersion fixed paraffin-embedded sections of human pituitary using Goat Anti-Human Neurophysin II Antigen Affinity-purified Polyclonal Antibody (Catalog # AF009) at 3 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (VC004). Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (CTS013). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cell cytoplasm. Staining was performed using our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
Species: Hu
Applications: IHC, WB
KCNK3 Antibody
(S374-48)
NBP2-42202
Western Blot: KCNK3 Antibody (S374-48) [NBP2-42202] - Western Blot analysis of Rat Brain Membrane showing detection of ~50 kDa TASK1 Potassium Channel protein using Mouse Anti-TASK1 Potassium Channel Monoclonal Antibody, Clone S374-48 (NBP2-42202). Lane 1: Molecular Weight Ladder (MW). Lane 2: Rat brain membrane. Load: 15 ug. Block: 2% BSA and 2% Skim Milk in 1X TBST. Primary Antibody: Mouse Anti-TASK1 Potassium Channel Monoclonal Antibody (NBP2-42202) at 1:1000 for 16 hours at 4C. Secondary Antibody: Goat Anti-Mouse IgG: HRP at 1:2000 for 60 min at RT. Color Development: ECL solution for 6 min at RT. Predicted/Observed Size: ~50 kDa.
Immunocytochemistry/Immunofluorescence: KCNK3 Antibody (S374-48) [NBP2-42202] - Immunocytochemistry/Immunofluorescence analysis using Mouse Anti-TASK1 Potassium Channel Monoclonal Antibody, Clone S374-48 (NBP2-42202). Tissue: Neuroblastoma cell line (SK-N-BE). Species: Human. Fixation: 4% Formaldehyde for 15 min at RT. Primary Antibody: Mouse Anti-TASK1 Potassium Channel Monoclonal Antibody (NBP2-42202) at 1:100 for 60 min at RT. Secondary Antibody: Goat Anti-Mouse ATTO 488 at 1:100 for 60 min at RT. Counterstain: Phalloidin Texas Red F-Actin stain; DAPI (blue) nuclear stain at 1:1000, 1:5000 for 60min RT, 5min RT. Localization: Membrane. Magnification: 60X. (A) DAPI (blue) nuclear stain. (B) Phalloidin Texas Red F-Actin stain. (C) TASK1 Potassium Channel Antibody. (D) Composite.
Immunocytochemistry/Immunofluorescence: KCNK3 Antibody (S374-48) [NBP2-42202] - Immunocytochemistry/Immunofluorescence analysis using Mouse Anti-TASK1 Potassium Channel Monoclonal Antibody, Clone S374-48 (NBP2-42202). Tissue: Neuroblastoma cells (SH-SY5Y). Species: Human. Fixation: 4% PFA for 15 min. Primary Antibody: Mouse Anti-TASK1 Potassium Channel Monoclonal Antibody (NBP2-42202) at 1:50 for overnight at 4C with slow rocking. Secondary Antibody: AlexaFluor 488 at 1:1000 for 1 hour at RT. Counterstain: Phalloidin-iFluor 647 (red) F-Actin stain; Hoechst (blue) nuclear stain at 1:800, 1.6mM for 20 min at RT. (A) Hoechst (blue) nuclear stain. (B) Phalloidin-iFluor 647 (red) F-Actin stain. (C) TASK1 Potassium Channel Antibody (D) Composite.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
POMC Antibody
NB100-1533
Western Blot: POMC Antibody [NB100-1533] - Staining of NIH3T3 cell lysate with antibody at 0.3 ug/mL (A) and Rat Brain cell lysate with antibody at 2 ug/mL (B). 35 ug protein in RIPA buffer. Detected by chemiluminescence.
Flow Cytometry: POMC Antibody [NB100-1533] - Flow cytometric analysis of paraformaldehyde fixed A431 cells (blue line), permeabilized with 0.5% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (1 ug/mL). IgG control: Unimmunized goat IgG (black line) followed by Alexa Fluor 488 secondary antibody.
Immunohistochemistry: POMC Antibody [NB100-1533] - Representative immunofluorescence images of (B) POMC as a prohormone (n = 5-6 each) in the ARC of mice approximately 5 to 10 weeks of age. Image collected and cropped by CiteAb from the following publication (jci.org/articles/view/96420), licensed under a CC-BY licence.
(10 Publications)
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Enolase
2/Neuron-specific Eno ...
NB110-58870
Immunocytochemistry/Immunofluorescence: Enolase 2/Neuron-specific Enolase Antibody [NB110-58870] - Analysis of mixed cortical neuron-glial cell culture from E20 rat stained with rabbit pAb to neuron specific enolase (NSE), NB110-58870, dilution 1:500 in red, and costained with chicken pAb to GFAP, dilution 1:5,000 in green. The blue is Hoechst staining of nuclear DNA. the NSE antibody labels protein expressed in neuronal cells, while the GFAP antibody stains intermediate filaments in astrocytic and certain other glial cells.
Western Blot: Enolase 2/Neuron-specific Enolase Antibody [NB110-58870] - Analysis of different tissue and cell lysates using rabbit pAb to neuron specific enolase (NSE), NB110-58870, dilution 1:5,000 in green: [1] protein standard (red), [2] rat brain, [3] rat spinal cord, [4] mouse brain, [5] mouse spinal cord, [6] NIH-3T3, [7] HEK293, [8] HeLa, [9] SH-SY5Y, and [10] C6 cells. A single band at about 47kDa corresponds to the NSE protein, seen only in extracts containing neurons ro neuronal lineage cells.
Simple Western: Enolase 2/Neuron-specific Enolase Antibody [NB110-58870] - Simple Western lane view shows a specific band for Enolase 2/ Neuron specific enolase in 0.05 mg/ml of Human Brain lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
(2 Reviews)
(5 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KD, Simple Western, WB
Ornithine
Carbamoyltransferase
NBP1-87408
Immunocytochemistry/Immunofluorescence: Ornithine Carbamoyltransferase Antibody [NBP1-87408] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Ornithine Carbamoyltransferase Antibody [NBP1-87408] - Staining of human kidney shows no positivity as expected.
Immunohistochemistry-Paraffin: Ornithine Carbamoyltransferase Antibody [NBP1-87408] - Staining of human liver cancer shows moderate to strong cytoplasmic positivity in tumor cells.
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
CRAT Antibody
NBP1-86616
Western Blot: CRAT Antibody [NBP1-86616] - Analysis in human cell line TD47D.
Western Blot: CRAT Antibody [NBP1-86616] - Analysis using Anti-CRAT antibody NBP1-86616 (A) shows similar pattern to independent antibody NBP1-86615 (B).
Immunohistochemistry-Paraffin: CRAT Antibody [NBP1-86616] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
GLYAT Antibody
NBP2-58917
Western Blot: GLYAT Antibody [NBP2-58917] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma and human liver tissue.
Immunohistochemistry-Paraffin: GLYAT Antibody [NBP2-58917] - Staining of human duodenum shows low expression as expected.
Immunohistochemistry-Paraffin: GLYAT Antibody [NBP2-58917] - Staining of human kidney shows high expression.
Species: Hu
Applications: IHC, IHC-P, WB
SLC25A21 Antibody
NBP1-82493
Immunohistochemistry-Paraffin: SLC25A21 Antibody [NBP1-82493] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.
Western Blot: SLC25A21 Antibody [NBP1-82493] - Lane 1: Marker [kDa] 207, 110, 79, 49, 32, 25, 17 Lane 3: Human cell line EFO-21
Species: Hu
Applications: IHC, IHC-P, WB

Publications for OAT Antibody (NBP1-83239) (0)

There are no publications for OAT Antibody (NBP1-83239).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OAT Antibody (NBP1-83239) (2) 52

Average Rating: 5
(Based on 2 reviews)
We have 2 reviews tested in 1 species: Bovine.

Reviews using NBP1-83239:
Filter by Applications
WB
(1)
Blocking test with OAT Recombinant Protein Antigen.
(1)
All Applications
Filter by Species
Bovine
(2)
All Species
Images Ratings Applications Species Date Details
Western Blot OAT NBP1-83239
Enlarge 		5
reviewed by:
Verified Customer
 WB Bovine 02/01/2019
View

Summary

ApplicationWestern Blot
Sample Testedcow liver tissue
SpeciesBovine
LotR38625
Other OAT NBP1-83239
Enlarge 		5
reviewed by:
Verified Customer
 Blocking test with OAT Recombinant Protein Antigen. Bovine 01/31/2019
View

Summary

ApplicationOther
Sample Testedcow liver tissue,cow liver tissues
SpeciesBovine
LotR38625

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for OAT Antibody (NBP1-83239) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional OAT Products

Bioinformatics Tool for OAT Antibody (NBP1-83239)

Discover related pathways, diseases and genes to OAT Antibody (NBP1-83239). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OAT Antibody (NBP1-83239)

Discover more about diseases related to OAT Antibody (NBP1-83239).
 

Pathways for OAT Antibody (NBP1-83239)

View related products by pathway.

PTMs for OAT Antibody (NBP1-83239)

Learn more about PTMs related to OAT Antibody (NBP1-83239).

Blogs on OAT

There are no specific blogs for OAT, but you can read our latest blog posts.
Download our IHC Handbook

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
2
4
0
3
0
2
0
1
0
Western Blot OAT NBP1-83239
Enlarge
 Verified Customer
02/01/2019
Application: WB
Species: Bovine
read this review
Other OAT NBP1-83239
Enlarge
 Verified Customer
01/31/2019
Application: Blocking test with OAT Recombinant Protein Antigen.
Species: Bovine
read this review

Bioinformatics

Gene Symbol OAT