Home » OAT » OAT Antibodies » OAT Antibody

OAT Antibody

 (2 Reviews)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: OAT Antibody [NBP1-83239] - Analysis in human duodenum and pancreas tissues. Corresponding OAT RNA-seq data are presented for the same tissues.
Orthogonal Strategies: Immunohistochemistry-Paraffin: OAT Antibody [NBP1-83239] - Analysis in human duodenum and pancreas tissues. Corresponding OAT RNA-seq data are presented for the same tissues.
Western Blot: OAT Antibody [NBP1-83239] - Analysis in control (vector only transfected HEK293T lysate) and OAT over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: OAT Antibody [NBP1-83239] - Staining of human duodenum shows strong granular cytoplasmic postivity in glandular cells.
Immunohistochemistry-Paraffin: OAT Antibody [NBP1-83239] - Staining of human cerebral cortex shows moderate to strong granular cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: OAT Antibody [NBP1-83239] - Staining of human testis shows moderate granular cytoplasmic positivity in Leydig cells.
Immunohistochemistry-Paraffin: OAT Antibody [NBP1-83239] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Product Details

Summary
Reactivity Hu, Bv, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

OAT Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ALKSQVDKLTLTSRAFYNNVLGEYEEYITKLFNYHKVLPMNTGVEAGETACKLARKWGYTVKGIQKYKAKIVFAAGNFWGRTLSAISSSTDPTSYDGFGPFMPGFDIIPYNDLPALERALQDPNVAAFMVEPIQGEAGV
Specificity
Specificity of human OAT antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
OAT
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.04 - 0.4 ug/mL
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
OAT Recombinant Protein Antigen (NBP1-83239PEP)
Reviewed Applications
Read 2 Reviews rated 5
using
NBP1-83239 in the following applications:

Reactivity Notes

Bovine reactivity reported from a verified customer review.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for OAT Antibody

  • GACR
  • HOGA
  • OAT ornithine aminotransferase
  • OATASE
  • OKT

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Ornithine
Decarboxylase Antibod ...
NBP2-32887
Western Blot: Ornithine Decarboxylase Antibody (ODC1/485) [NBP2-32887] - Analysis using the Azide and BSA Free version of NBP2-32887. Detection of ODC1 in human placental lysate
Immunocytochemistry/Immunofluorescence: Ornithine Decarboxylase Antibody (ODC1/485) [NBP2-32887] - IF staining of LNCap cells using AF488 labeled ODC1 Monoclonal Antibody (ODC1/485) (GREEN) DAPI was used to stain the cell nucleus (blue). Image using the Azide and BSA Free format of this antibody.
Immunohistochemistry-Paraffin: Ornithine Decarboxylase Antibody (ODC1/485) [NBP2-32887] - Formalin-fixed, paraffin-embedded Mouse Pancreas stained with Ornithine Decarboxylase Antibody (ODC1/485).
(1 Review)
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
SLC22A6 Antibody
(1F2)
H00009356-M05
Immunohistochemistry-Paraffin: SLC22A6 Antibody (1F2) [H00009356-M05] - Analysis of monoclonal antibody to SLC22A6 on formalin-fixed paraffin-embedded human kidney. Antibody concentration 3 ug/ml
ELISA: SLC22A6 Antibody (1F2) [H00009356-M05] - Detection limit for recombinant GST tagged SLC22A6 is 3 ng/ml as a capture antibody.
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Insulin Antibody
(E2-E3 (same as INS04 ...
NBP2-34260
Western Blot: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Probing of Western blots of pancreatic lysates from control and iron overloaded Tg40 PrP and PrP-/- mice with antibodies specific for insulin dimer and pentamer (upper and lower panels) shows decreased expression in Tg40 PrP relative to PrP-/- samples (lanes 1 & 5 vs. 3 & 7). Image collected and cropped by CiteAb from the following publication (nature.com/articles/s41598-018-24786-1), licensed under a CC-BY licence.
Immunohistochemistry: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Immunohistochemistry of pancreas shows relatively higher reactivity for insulin in PrP-/- relative to Tg40 PrP sections (panels 1 & 3). Iron overloading decreases insulin reactivity in Tg40 PrP but not in PrP-/- samples (panels 1 vs. 2 & 3 vs. 4). Reaction for glucagon is higher in iron overloaded Tg40 PrP relative to control samples (panels 5 & 6). The difference is minimal in PrP-/- samples (panels 7 & 8). Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41598-018-24786-1), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Formalin-fixed, paraffin-embedded human pancreas stained with insulin Monoclonal Antibody (E2-E3)
(5 Reviews)
(1 Publication)
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Coagulation Factor
II/Thrombin Antibody
NBP1-58268
Western Blot: Coagulation Factor II/Thrombin Antibody [NBP1-58268] - 721_B tissue lysate at a concentration of 1ug/ml.
Immunohistochemistry: Coagulation Factor II/Thrombin Antibody [NBP1-58268] - Analysis of human liver after heat-induced Antigen retrieval. Antibody concentration 5 ug/ml.
Immunohistochemistry-Paraffin: Coagulation Factor II/Thrombin Antibody [NBP1-58268] - Human Placenta Tissue
(1 Review)
(3 Publications)
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Glutamine
Synthetase Antibody
NB110-41404
Western Blot: Glutamine Synthetase Antibody [NB110-41404] - Analysis of glutamine synthase. 40ug of lysates from mouse (Lanes M), rat (Lane R), pig (Lane P), bovine (Lane B), or human (Lane Hu) retina were probed. A 42 kDa band was identified in lysates from retinas of all species.
Immunocytochemistry/Immunofluorescence: Glutamine Synthetase Antibody [NB110-41404] - Immunofluorescence using NB110-41404. Submitted via verified customer review.
Immunohistochemistry: Glutamine Synthetase Antibody [NB110-41404] - Localization of glutamine synthase in the retina. Paraffin sections of mouse (A, B), rat (C, D, G-I), or human (E, F) retina fixed in 4% paraformaldehyde were reacted with anti-glutamine synthase (red fluorescence staining in B, D, G, I, and brown immuno-peroxidase reaction. Nuclei in IF experiments (A-D) were stained with DAPI (cyan), and with nuclear fast red in E and F. At low magnification, anti-glutamine synthase reacted with a single population of cells extending from the ganglion cell layer through the inner nuclear layer. No signal was detected in controls either pre-incubated with 100ug/ml of the immunizing peptide (A) or with pre-immune serum (C, E). This finding was confirmed by co-localization (indicated by yellow in I) of glutamine synthase (red in G) with antoher marker of glutamine synthase (green in H).
(1 Review)
(6 Publications)
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC
LIGHT/TNFSF14
[Unconjugated]
664-LI/CF
1 µg/lane of Recombinant Human LIGHT/TNFSF14 (Catalog # 664-LI/CF) was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a band at 25 kDa.
Recombinant Human LIGHT/TNFSF14 (Catalog # 664-LI/CF) stimulates cell proliferation in HUVEC human umbilical vein endothelial cells. The ED50 is 1-4 ng/mL.
(16 Publications)
Species: Hu
SLC22A8 Antibody
H00009376-B01P
Western Blot: SLC22A8 Antibody [H00009376-B01P] - Analysis of SLC22A8 expression in rat kidney.
Western Blot: SLC22A8 Antibody [H00009376-B01P] - Analysis of SLC22A8 expression in transfected 293T cell line by SLC22A8 polyclonal antibody. Lane 1: SLC22A8 transfected lysate(59.62 KDa). Lane 2: Non-transfected lysate.
(1 Publication)
Species: Hu, Rt
Applications: WB, IHC
Glutaminyl-peptide
Cyclotransferase/QPCT ...
NBP1-81838
Immunohistochemistry-Paraffin: Glutaminyl-peptide Cyclotransferase/QPCT Antibody [NBP1-81838] - Staining in human adrenal gland and liver tissues using anti-QPCT antibody. Corresponding QPCT RNA-seq data are presented for the same tissues.
Western Blot: Glutaminyl-peptide Cyclotransferase/QPCT Antibody [NBP1-81838] - Analysis in control (vector only transfected HEK293T lysate) and QPCT over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Western Blot: Glutaminyl-peptide Cyclotransferase/QPCT Antibody [NBP1-81838] - Analysis in human cell line SK-MEL-30.
(1 Publication)
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Recombinant Human
AGA Protein
NBP2-52631
SDS-Page: Recombinant Human AGA Protein [NBP2-52631]
(1 Publication)
Species: Hu
GLS2 Antibody
NBP1-76544
Western Blot: GLS2 Antibody [NBP1-76544] - Glutaminase protein expression in PC3 and PC3M cell lines before/after CB-839 treatment. PC3 & PC3M cells were treated (+) or not treated (-) with GLS1 inhibitor CB-839 (1 uM) and their expression of GLS1 & GLS2 proteins determined by Western blot. Antibodies specific for GAC & KCA were utilized on two replicate samples, while GLS2 expression was determined on three. PC3 cell lysates expressed GLS2 more than PC3M cell lysates regardless of CB-839 treatment. The difference in GLS2 expression was significant in the untreated cells (P?<?0.03) but because of high variability the difference was not significant in the drug-treated cells. Levels of GLS1 (GAC and KGA) were similar in all cell lysates. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41598-017-16327-z), licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: GLS2 Antibody [NBP1-76544] - of GLS2 in Human Kidney cells. Dilution 20 ug/mL.
Immunohistochemistry: GLS2 Antibody [NBP1-76544] - Immunohistochemistry of GLS2 in human kidney tissue with GLS2 antibody at 5 ug/mL.
(3 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P
Catalase Antibody
NBP2-24916
Western Blot: Catalase Antibody [NBP2-24916] - Analysis in liver lysate of 1) human 2) mouse and 3) rat at 0.1 ug/ml.
Immunohistochemistry-Paraffin: Catalase Antibody [NBP2-24916] - Staining of human liver tissue using an isotype control (top) and this antibody (bottom) at 5 ug/ml.
(1 Review)
(7 Publications)
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
DMPK Antibody
(713931)
MAB6967
Western blot shows lysates of human heart tissue. PVDF membrane was probed with 2 µg/mL of Mouse Anti-Human DMPK Monoclonal Antibody (Catalog # MAB6967) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for DMPK at approximately 74 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu
Applications: WB
Human Copeptin
ELISA Kit (Colorimetr
NBP2-69822
Human Copeptin ELISA Kit (Colorimetric) - Standard Curve Reference
(1 Publication)
Species: Hu
KCNK3 Antibody
(S374-48)
NBP2-42202
Western Blot: KCNK3 Antibody (S374-48) [NBP2-42202] - Analysis of Rat Brain Membrane showing detection of ~50 kDa TASK1 Potassium Channel protein using Mouse Anti-TASK1 Potassium Channel Monoclonal Antibody, Clone S374-48. Lane 1: Molecular Weight Ladder (MW). Lane 2: Rat brain membrane. Load: 15 ug. Block: 2% BSA and 2% Skim Milk in 1X TBST. Primary Antibody: Mouse Anti-TASK1 Potassium Channel Monoclonal Antibody at 1:1000 for 16 hours at 4 degrees C. Secondary Antibody: Goat Anti-Mouse IgG: HRP at 1:2000 for 60 min at RT. Color Development: ECL solution for 6 min at RT. Predicted/Observed Size: 50 kDa.
Immunocytochemistry/Immunofluorescence: KCNK3 Antibody (S374-48) [NBP2-42202] - Tissue: Neuroblastoma cell line SK-N-BE. Species: Human. Fixation: 4% Formaldehyde for 15 min at RT. Primary Antibody: Mouse Anti-TASK1 Potassium Channel Monoclonal Antibody at 1:100 for 60 min at RT. Secondary Antibody: Goat Anti-Mouse ATTO 488 at 1:100 for 60 min at RT. Counterstain: Phalloidin Texas Red F-Actin stain; DAPI (blue) nuclear stain at 1:1000, 1:5000 for 60min RT, 5min RT. Localization: Membrane. Magnification: 60X.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
POMC Antibody
NB100-1533
Western Blot: POMC Antibody [NB100-1533] - Staining of NIH3T3 cell lysate with antibody at 0.3 ug/mL (A) and Rat Brain cell lysate with antibody at 2 ug/mL (B). 35 ug protein in RIPA buffer. Detected by chemiluminescence.
Immunohistochemistry: POMC Antibody [NB100-1533] - Representative confocal images of POMC in POMC-transfected WT and Sel1L-/- N2a cells. White arrows point to POMC-containing secretory granules, while yellow arrows point to perinuclear POMC. KDEL marks the ER. Representative data from at least 2 independent experiments are shown. Image collected and cropped by CiteAb from the following publication (jci.org/articles/view/96420), licensed under a CC-BY licence.
Flow Cytometry: POMC Antibody [NB100-1533] - Flow cytometric analysis of paraformaldehyde fixed A431 cells (blue line), permeabilized with 0.5% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (1 ug/mL). IgG control: Unimmunized goat IgG (black line) followed by Alexa Fluor 488 secondary antibody.
(10 Publications)
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
Enolase
2/Neuron-specific Eno ...
NB110-58870
Western Blot: Enolase 2/Neuron-specific Enolase Antibody [NB110-58870] - Analysis of different tissue and cell lysates using rabbit pAb to neuron specific enolase (NSE), NB110-58870, dilution 1:5,000 in green: [1] protein standard (red), [2] rat brain, [3] rat spinal cord, [4] mouse brain, [5] mouse spinal cord, [6] NIH-3T3, [7] HEK293, [8] HeLa, [9] SH-SY5Y, and [10] C6 cells. A single band at about 47kDa corresponds to the NSE protein, seen only in extracts containing neurons ro neuronal lineage cells.
Immunocytochemistry/Immunofluorescence: Enolase 2/Neuron-specific Enolase Antibody [NB110-58870] - Analysis of mixed cortical neuron-glial cell culture from E20 rat stained with rabbit pAb to neuron specific enolase (NSE), NB110-58870, dilution 1:500 in red, and costained with chicken pAb to GFAP, dilution 1:5,000 in green. The blue is Hoechst staining of nuclear DNA. the NSE antibody labels protein expressed in neuronal cells, while the GFAP antibody stains intermediate filaments in astrocytic and certain other glial cells.
Western Blot: Enolase 2/Neuron-specific Enolase Antibody [NB110-58870] - Blot of rat spinal cord probed with rabbit antibody to NSE. The antibody stains a single sharp band corresponing to NSE at about 47kDa.
(2 Reviews)
(4 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, KD
Ornithine
Carbamoyltransferase
NBP1-87408
Immunohistochemistry-Paraffin: Ornithine Carbamoyltransferase Antibody [NBP1-87408] - Staining in human liver and kidney tissues. Corresponding OTC RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Ornithine Carbamoyltransferase Antibody [NBP1-87408] - Staining of human cerebral cortex, kidney, liver and small intestine using Anti-OTC antibody NBP1-87408 (A) shows similar protein distribution across tissues to independent antibody NBP1-88121 (B).
Western Blot: Ornithine Carbamoyltransferase Antibody [NBP1-87408] - Analysis in human liver tissue.
(3 Publications)
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
CRAT Antibody
NBP1-86616
Immunohistochemistry-Paraffin: CRAT Antibody [NBP1-86616] - Analysis in human testis and lymph node tissues. Corresponding CRAT RNA-seq data are presented for the same tissues.
Western Blot: CRAT Antibody [NBP1-86616] - Analysis using Anti-CRAT antibody NBP1-86616 (A) shows similar pattern to independent antibody NBP1-86615 (B).
Western Blot: CRAT Antibody [NBP1-86616] - Analysis in human cell line TD47D.
Species: Hu
Applications: WB, IHC, IHC-P
GLYAT Antibody
NBP2-58917
Western Blot: GLYAT Antibody [NBP2-58917] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma and human liver tissue.
Immunohistochemistry-Paraffin: GLYAT Antibody [NBP2-58917] - Staining of human skeletal muscle.
Immunohistochemistry-Paraffin: GLYAT Antibody [NBP2-58917] - Staining of human duodenum shows low expression as expected.
Species: Hu
Applications: WB, IHC, IHC-P
SLC25A21 Antibody
NBP1-82493
Western Blot: SLC25A21 Antibody [NBP1-82493] - Lane 1: Marker [kDa] 207, 110, 79, 49, 32, 25, 17 Lane 3: Human cell line EFO-21
Immunohistochemistry-Paraffin: SLC25A21 Antibody [NBP1-82493] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.
Species: Hu
Applications: WB, IHC, IHC-P

Publications for OAT Antibody (NBP1-83239) (0)

There are no publications for OAT Antibody (NBP1-83239).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OAT Antibody (NBP1-83239) (2) 52

Average Rating: 5
(Based on 2 reviews)
We have 2 reviews tested in 1 species: Bovine.

Reviews using NBP1-83239:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Bovine
(2)
All Species
Images Ratings Applications Species Date Details
Western Blot OAT NBP1-83239
Enlarge 		5
reviewed by:
Kwangwon son
 WB Bovine 02/01/2019
View

Summary

ApplicationWestern Blot
Sample Testedcow liver tissue
SpeciesBovine
LotR38625
OAT NBP1-83239
Enlarge 		5
reviewed by:
Kwangwon son
 Bovine 01/31/2019
View

Summary

Sample Testedcow liver tissue,cow liver tissues
SpeciesBovine
LotR38625

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for OAT Antibody (NBP1-83239) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional OAT Products

Bioinformatics Tool for OAT Antibody (NBP1-83239)

Discover related pathways, diseases and genes to OAT Antibody (NBP1-83239). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OAT Antibody (NBP1-83239)

Discover more about diseases related to OAT Antibody (NBP1-83239).
 

Pathways for OAT Antibody (NBP1-83239)

View related products by pathway.

PTMs for OAT Antibody (NBP1-83239)

Learn more about PTMs related to OAT Antibody (NBP1-83239).

Blogs on OAT

There are no specific blogs for OAT, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
2
4
0
3
0
2
0
1
0
Western Blot OAT NBP1-83239
Enlarge
 Kwangwon son
02/01/2019
Application: WB
Species: Bovine
read this review
OAT NBP1-83239
Enlarge
 Kwangwon son
01/31/2019
Application:
Species: Bovine
read this review

Bioinformatics

Gene Symbol OAT