Home » OAT » OAT Antibodies » OAT Antibody

OAT Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: OAT Antibody [NBP1-83239] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Western Blot: OAT Antibody [NBP1-83239] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a ...read more
Immunohistochemistry-Paraffin: OAT Antibody [NBP1-83239] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: OAT Antibody [NBP1-83239] - Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: OAT Antibody [NBP1-83239] - Staining in human duodenum and pancreas tissues using anti-OAT antibody. Corresponding OAT RNA-seq data are presented for the same tissues.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

OAT Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ALKSQVDKLTLTSRAFYNNVLGEYEEYITKLFNYHKVLPMNTGVEAGETACKLARKWGYTVKGIQKYKAKIVFAAGNFWGRTLSAISSSTDPTSYDGFGPFMPGFDIIPYNDLPALERALQDPNVAAFMVEPIQGEAGV
Specificity
Specificity of human OAT antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
OAT
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
OAT Protein (NBP1-83239PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for OAT Antibody

  • GACR
  • HOGA
  • OAT ornithine aminotransferase
  • OATASE
  • OKT

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Ornithine
Decarboxylase Antibod ...
NBP2-32887
Western Blot: Ornithine Decarboxylase Antibody (ODC1/485) [NBP2-32887] - Analysis using the Azide and BSA Free version of NBP2-32887. Detection of ODC1 in human placental lysate
Immunohistochemistry-Paraffin: Ornithine Decarboxylase Antibody (ODC1/485) [NBP2-32887] - Formalin-fixed, paraffin-embedded Rat pancreas stained with ODC1 Monoclonal Antibody (ODC1/485)
Flow Cytometry: Ornithine Decarboxylase Antibody (ODC1/485) [NBP2-32887] - Flow Cytometry of human ODC1 on PC3 Cells. Black: cells alone: Grey isotype control: Green: AF488-labeled ODC1 Monoclonal Antibody (ODC1/485)
(1 Review)
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, PAGE, IF
SLC22A6 Antibody
NBP2-62690
Immunohistochemistry-Paraffin: SLC22A6 Antibody [NBP2-62690] - Staining of human kidney shows high expression.
Immunohistochemistry-Paraffin: SLC22A6 Antibody [NBP2-62690] - Analysis in human kidney and lymph node tissues using Anti-SLC22A6 antibody. Corresponding SLC22A6 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: SLC22A6 Antibody [NBP2-62690] - Staining of human lymph node shows low expression as expected.
Species: Hu
Applications: IHC, IHC-P
Insulin Antibody
(E2-E3 (same as INS04 ...
NBP2-34260
Immunohistochemistry-Paraffin: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Formalin-fixed, paraffin-embedded human pancreas stained with insulin Monoclonal Antibody (E2-E3)
SDS-Page: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260]
(4 Reviews)
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Coagulation Factor
II/Thrombin Antibody
NBP1-58268
Western Blot: Coagulation Factor II/Thrombin Antibody [NBP1-58268] - 721_B tissue lysate at a concentration of 1ug/ml.
Immunohistochemistry: Coagulation Factor II/Thrombin Antibody [NBP1-58268] - Analysis of human liver after heat-induced Antigen retrieval. Antibody concentration 5 ug/ml.
Immunohistochemistry-Paraffin: Coagulation Factor II/Thrombin Antibody [NBP1-58268] - Human Placenta Tissue
(1 Review)
Species: Hu
Applications: WB, IHC, IHC-P
Glutamine
Synthetase Antibody
NB110-41404
Western Blot: Glutamine Synthetase Antibody [NB110-41404] - Analysis of glutamine synthase. 40ug of lysates from mouse (Lanes M), rat (Lanes R), pig (Lanes P), bovine (Lanes B), or human (Lanes Hu) retina were probed. A 42 kDa band was identified in lysates from retinas of all species.
Immunohistochemistry: Glutamine Synthetase Antibody [NB110-41404] - Localization of glutamine synthase in the retina. Paraffin sections of mouse (A, B), rat (C, D, G-I), or human (E, F) retina fixed in 4% paraformaldehyde were reacted with anti-glutamine synthase (red fluorescence staining in B, D, G, I, and brown immuno-peroxidase reaction [using ABC kit and visualization with DAB product in F]. Nuclei in some immunofluorescence experiments (A-D) were stained with DAPI (shown in cyan), and with nuclear fast red in E and F. On inspection at low magnification, anti- glutamine synthase reacted with a single population of cells extending from the ganglion cell layer (GCL) through the inner nuclear layer (INL). No signal was detected in controls either pre-incubated with 100ug/ml of the immunizing peptide (A) or with pre-immune serum (C, E). The pattern of staining observed in all experiments is typicals. This finding was confirmed by co-localization (indicated by yellow in I) of glutamine synthase (red in G) with antoher marker of glutamine synthase (green in H).
(1 Review)
(4 Publications)
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
LIGHT/TNFSF14
[Unconjugated]
664-LI
1 µg/lane of Recombinant Human LIGHT/TNFSF14 (Catalog # 664-LI was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a band at 25 kDa.
Recombinant Human LIGHT/TNFSF14 (Catalog # 664-LI) stimulates cell proliferation in HUVEC human umbilical vein endothelial cells. The ED50 is 1-4 ng/mL.
(12 Publications)
Species: Hu
SLC22A8 Antibody
NBP1-92396
Immunohistochemistry-Paraffin: SLC22A8 Antibody [NBP1-92396] - Staining of human lymph node shows low expression as expected.
Immunohistochemistry-Paraffin: SLC22A8 Antibody [NBP1-92396] - Staining of human kidney shows high expression.
Immunohistochemistry-Paraffin: SLC22A8 Antibody [NBP1-92396] - Staining in human kidney and lymph node tissues using anti-SLC22A8 antibody. Corresponding SLC22A8 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: IHC, IHC-P
Glutaminyl-peptide
Cyclotransferase/QPCT ...
NBP1-81838
Western Blot: Glutaminyl-peptide Cyclotransferase/QPCT Antibody [NBP1-81838] - Analysis in human cell line SK-MEL-30.
Immunohistochemistry-Paraffin: Glutaminyl-peptide Cyclotransferase/QPCT Antibody [NBP1-81838] - Staining of human liver shows low expression as expected.
Immunohistochemistry: Glutaminyl-peptide Cyclotransferase/QPCT Antibody [NBP1-81838] - Staining of human adrenal gland shows high expression.
(1 Publication)
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AGA Antibody
NBP1-88866
Immunocytochemistry/Immunofluorescence: AGA Antibody [NBP1-88866] - Staining of human cell line U-2 OS shows positivity in vesicles and cytoskeleton (microtubules).
Immunohistochemistry-Paraffin: AGA Antibody [NBP1-88866] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: AGA Antibody [NBP1-88866] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
GLS2 Antibody
NBP1-76544
Immunocytochemistry/Immunofluorescence: GLS2 Antibody [NBP1-76544] - of GLS2 in Human Kidney cells. Dilution 20 ug/mL.
Immunohistochemistry: GLS2 Antibody [NBP1-76544] - Immunohistochemistry of GLS2 in human kidney tissue with GLS2 antibody at 5 ug/mL.
Simple Western: GLS2 Antibody [NBP1-76544] - Simple Western lane view shows a specific band for GLS2 in 0.5 mg/ml of Hek293 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P
Catalase Antibody
NBP2-24916
Western Blot: Catalase Antibody [NBP2-24916] - Analysis in liver lysate of 1) human 2) mouse and 3) rat at 0.1 ug/ml.
Immunohistochemistry-Paraffin: Catalase Antibody [NBP2-24916] - Staining of human liver tissue using an isotype control (top) and this antibody (bottom) at 5 ug/ml.
(1 Review)
(4 Publications)
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
DMPK Antibody
NBP1-85010
Western Blot: DMPK Antibody [NBP1-85010] - Analysis in human cell lines U-251MG and Caco-2 using Anti-DMPK antibody. Corresponding DMPK RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
Immunohistochemistry-Paraffin: DMPK Antibody [NBP1-85010] - Staining in human smooth muscle and liver tissues using anti-DMPK antibody. Corresponding DMPK RNA-seq data are presented for the same tissues.
Western Blot: DMPK Antibody [NBP1-85010] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: A-549
Species: Hu
Applications: WB, IHC, IHC-P
Arg-Vasopressin
Antibody
NB100-65214
Arg-Vasopressin Antibody
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
KCNK3 Antibody
(S374-48)
NBP2-42202
Western Blot: KCNK3 Antibody (S374-48) [NBP2-42202] - Analysis of Rat Brain Membrane showing detection of ~50 kDa TASK1 Potassium Channel protein using Mouse Anti-TASK1 Potassium Channel Monoclonal Antibody, Clone S374-48. Lane 1: Molecular Weight Ladder (MW). Lane 2: Rat brain membrane. Load: 15 ug. Block: 2% BSA and 2% Skim Milk in 1X TBST. Primary Antibody: Mouse Anti-TASK1 Potassium Channel Monoclonal Antibody at 1:1000 for 16 hours at 4 degrees C. Secondary Antibody: Goat Anti-Mouse IgG: HRP at 1:2000 for 60 min at RT. Color Development: ECL solution for 6 min at RT. Predicted/Observed Size: 50 kDa.
Immunocytochemistry/Immunofluorescence: KCNK3 Antibody (S374-48) [NBP2-42202] - Tissue: Neuroblastoma cell line SK-N-BE. Species: Human. Fixation: 4% Formaldehyde for 15 min at RT. Primary Antibody: Mouse Anti-TASK1 Potassium Channel Monoclonal Antibody at 1:100 for 60 min at RT. Secondary Antibody: Goat Anti-Mouse ATTO 488 at 1:100 for 60 min at RT. Counterstain: Phalloidin Texas Red F-Actin stain; DAPI (blue) nuclear stain at 1:1000, 1:5000 for 60min RT, 5min RT. Localization: Membrane. Magnification: 60X.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
POMC Antibody
NB100-1533
Western Blot: POMC Antibody [NB100-1533] - Western blot analysis of POMC using NB100-1533 at 0.01ug/ml in NIH 3T3 lysate (35ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence.
Immunohistochemistry-Paraffin: POMC Antibody [NB100-1533] - Analysis in human Anterior Pituitary Gland shows vesilulate staining in glandular cells.
(7 Publications)
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Enolase
2/Neuron-specific Eno ...
NB110-58870
Western Blot: Enolase 2/Neuron-specific Enolase Antibody [NB110-58870] - Analysis of different tissue and cell lysates using rabbit pAb to neuron specific enolase (NSE), NB110-58870, dilution 1:5,000 in green: [1] protein standard (red), [2] rat brain, [3] rat spinal cord, [4] mouse brain, [5] mouse spinal cord, [6] NIH-3T3, [7] HEK293, [8] HeLa, [9] SH-SY5Y, and [10] C6 cells. A single band at about 47kDa corresponds to the NSE protein, seen only in extracts containing neurons ro neuronal lineage cells.
Immunocytochemistry/Immunofluorescence: Enolase 2/Neuron-specific Enolase Antibody [NB110-58870] - Analysis of mixed cortical neuron-glial cell culture from E20 rat stained with rabbit pAb to neuron specific enolase (NSE), NB110-58870, dilution 1:500 in red, and costained with chicken pAb to GFAP, dilution 1:5,000 in green. The blue is Hoechst staining of nuclear DNA. the NSE antibody labels protein expressed in neuronal cells, while the GFAP antibody stains intermediate filaments in astrocytic and certain other glial cells.
Western Blot: Enolase 2/Neuron-specific Enolase Antibody [NB110-58870] - Blot of rat spinal cord probed with rabbit antibody to NSE. The antibody stains a single sharp band corresponing to NSE at about 47kDa.
(2 Reviews)
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC
Ornithine
Carbamoyltransferase
NBP1-87408
Western Blot: Ornithine Carbamoyltransferase Antibody [NBP1-87408] - Analysis in human liver tissue.
Immunocytochemistry/Immunofluorescence: Ornithine Carbamoyltransferase Antibody [NBP1-87408] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Ornithine Carbamoyltransferase Antibody [NBP1-87408] - Staining in human liver and kidney tissues. Corresponding OTC RNA-seq data are presented for the same tissues.
(2 Publications)
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
CRAT Antibody
NBP1-86614
Western Blot: CRAT Antibody [NBP1-86614] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human liver tissue
Immunohistochemistry-Paraffin: CRAT Antibody [NBP1-86614] - Staining of human tonsil shows low expression as expected.
Immunohistochemistry-Paraffin: CRAT Antibody [NBP1-86614] - Analysis in human testis and tonsil tissues using Anti-CRAT antibody. Corresponding CRAT RNA-seq data are presented for the same tissues.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
GLYAT Antibody
NBP2-55298
Western Blot: GLYAT Antibody [NBP2-55298] - Analysis in human cell line RT-4 and human cell line U-251 MG.
Immunohistochemistry-Paraffin: GLYAT Antibody [NBP2-55298] - Staining in human kidney and skeletal muscle tissues using anti-GLYAT antibody. Corresponding GLYAT RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: GLYAT Antibody [NBP2-55298] - Staining of human kidney shows high expression.
Species: Hu
Applications: WB, IHC, IHC-P
SLC25A21 Antibody
NBP1-82493
Western Blot: SLC25A21 Antibody [NBP1-82493] - Lane 1: Marker [kDa] 207, 110, 79, 49, 32, 25, 17 Lane 3: Human cell line EFO-21
Immunohistochemistry-Paraffin: SLC25A21 Antibody [NBP1-82493] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.
Species: Hu
Applications: WB, IHC, IHC-P

Publications for OAT Antibody (NBP1-83239) (0)

There are no publications for OAT Antibody (NBP1-83239).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OAT Antibody (NBP1-83239) (0)

There are no reviews for OAT Antibody (NBP1-83239). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for OAT Antibody (NBP1-83239) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for OAT Antibody (NBP1-83239)

Discover related pathways, diseases and genes to OAT Antibody (NBP1-83239). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OAT Antibody (NBP1-83239)

Discover more about diseases related to OAT Antibody (NBP1-83239).
 

Pathways for OAT Antibody (NBP1-83239)

View related products by pathway.

PTMs for OAT Antibody (NBP1-83239)

Learn more about PTMs related to OAT Antibody (NBP1-83239).

Blogs on OAT

There are no specific blogs for OAT, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our OAT Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol OAT