OAT Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: OAT Antibody [NBP1-83239] - Analysis in human duodenum and pancreas tissues. Corresponding OAT RNA-seq data are presented for the same tissues.
Western Blot: OAT Antibody [NBP1-83239] - Analysis in control (vector only transfected HEK293T lysate) and OAT over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: OAT Antibody [NBP1-83239] - Staining of human duodenum shows strong granular cytoplasmic postivity in glandular cells.
Immunohistochemistry-Paraffin: OAT Antibody [NBP1-83239] - Staining of human cerebral cortex shows moderate to strong granular cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: OAT Antibody [NBP1-83239] - Staining of human testis shows moderate granular cytoplasmic positivity in Leydig cells.
Immunohistochemistry-Paraffin: OAT Antibody [NBP1-83239] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Product Details

Summary
Reactivity Hu, Bv, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

OAT Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ALKSQVDKLTLTSRAFYNNVLGEYEEYITKLFNYHKVLPMNTGVEAGETACKLARKWGYTVKGIQKYKAKIVFAAGNFWGRTLSAISSSTDPTSYDGFGPFMPGFDIIPYNDLPALERALQDPNVAAFMVEPIQGEAGV
Specificity
Specificity of human OAT antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
OAT
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04 - 0.4 ug/mL
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
OAT Recombinant Protein Antigen (NBP1-83239PEP)
Reviewed Applications
Read 2 Reviews rated 5
using
NBP1-83239 in the following applications:

Reactivity Notes

Bovine reactivity reported from a verified customer review.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for OAT Antibody

  • GACR
  • HOGA
  • OAT ornithine aminotransferase
  • OATASE
  • OKT

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-32887
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
H00009356-M05
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-58268
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC
H00009376-B01P
Species: Hu, Rt
Applications: WB, IHC
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-76544
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
MAB6967
Species: Hu
Applications: WB
NBP2-42202
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NB100-1533
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NB110-58870
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, KD
NBP1-87408
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-86616
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-58917
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-82493
Species: Hu
Applications: WB, IHC, IHC-P

Publications for OAT Antibody (NBP1-83239) (0)

There are no publications for OAT Antibody (NBP1-83239).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OAT Antibody (NBP1-83239) (2) 52

Average Rating: 5
(Based on 2 reviews)
We have 2 reviews tested in 1 species: Bovine.

Reviews using NBP1-83239:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Bovine
(2)
All Species
Images Ratings Applications Species Date Details
Western Blot OAT NBP1-83239
Enlarge
5
reviewed by:
Kwangwon son
WB Bovine 02/01/2019
View

Summary

ApplicationWestern Blot
Sample Testedcow liver tissue
SpeciesBovine
LotR38625
 OAT NBP1-83239
Enlarge
5
reviewed by:
Kwangwon son
Bovine 01/31/2019
View

Summary

Sample Testedcow liver tissue,cow liver tissues
SpeciesBovine
LotR38625

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for OAT Antibody (NBP1-83239) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional OAT Products

Bioinformatics Tool for OAT Antibody (NBP1-83239)

Discover related pathways, diseases and genes to OAT Antibody (NBP1-83239). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OAT Antibody (NBP1-83239)

Discover more about diseases related to OAT Antibody (NBP1-83239).
 

Pathways for OAT Antibody (NBP1-83239)

View related products by pathway.

PTMs for OAT Antibody (NBP1-83239)

Learn more about PTMs related to OAT Antibody (NBP1-83239).

Blogs on OAT

There are no specific blogs for OAT, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
2
4
0
3
0
2
0
1
0

Kwangwon son
02/01/2019
Application: WB
Species: Bovine

Kwangwon son
01/31/2019
Application:
Species: Bovine

Bioinformatics

Gene Symbol OAT