Recombinant Human SLC22A9 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SLC22A9 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 238 of Human SLC22A9 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAFQDLLGHAGDLWRFQILQTVFLSIFAVATYLHFMLENFTAFIPGHRCWVHILDNDTVSDNDTGALSQDALLRISIPLDSNMRPEKCRRFVHPQWQLLHLNGTFPNTSDADMEPCVDGWVYDRISFSSTIVTEWDLVCDSQSLTSVAKFVFMAGMMVGGILGGHLSDSSRVGNTQIPGHGNYIGNVPFWYCIYDPGRPGFCHSRLAYPPAGGVCTILCDLSDLKLAARVCSVAHYQQ

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
SLC22A9

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SLC22A9 Protein

  • FLJ23666
  • HOAT4
  • OAT4UST3H
  • OAT7
  • Organic anion transporter 4
  • organic anion transporter 7
  • solute carrier family 22 (organic anion transporter), member 9
  • solute carrier family 22 (organic anion/cation transporter), member 9
  • solute carrier family 22 member 9
  • UST3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00009356-M05
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-92396
Species: Hu
Applications: IHC, IHC-P
NBP1-62660
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-69536
Species: Hu
Applications: WB
NBP2-42202
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
H00116085-M02
Species: Hu
Applications: WB, ELISA
NBP1-32390
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22124
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-1471
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-42349
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-51684
Species: Hu
Applications: WB, ELISA, Flow
NBP1-59811
Species: Hu
Applications: WB, ICC/IF, IHC
NBP1-89417
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
NBP2-56965
Species: Hu
Applications: WB, ICC/IF
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NBP1-76670
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-82502
Species: Hu
Applications: IHC, IHC-P
H00005452-D01P
Species: Hu, Mu, Rt
Applications: WB
H00114571-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for SLC22A9 Recombinant Protein (H00114571-P01) (0)

There are no publications for SLC22A9 Recombinant Protein (H00114571-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC22A9 Recombinant Protein (H00114571-P01) (0)

There are no reviews for SLC22A9 Recombinant Protein (H00114571-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC22A9 Recombinant Protein (H00114571-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SLC22A9 Products

Bioinformatics Tool for SLC22A9 Recombinant Protein (H00114571-P01)

Discover related pathways, diseases and genes to SLC22A9 Recombinant Protein (H00114571-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC22A9 Recombinant Protein (H00114571-P01)

Discover more about diseases related to SLC22A9 Recombinant Protein (H00114571-P01).
 

Pathways for SLC22A9 Recombinant Protein (H00114571-P01)

View related products by pathway.

PTMs for SLC22A9 Recombinant Protein (H00114571-P01)

Learn more about PTMs related to SLC22A9 Recombinant Protein (H00114571-P01).

Blogs on SLC22A9

There are no specific blogs for SLC22A9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SLC22A9 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC22A9