SLC22A11 Antibody - BSA Free

Western Blot: SLC22A11 Antibody [NBP2-94224] - Western blot analysis of extracts of various cell lines, using SLC22A11 antibody (NBP2-94224) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SLC22A11 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SLC22A11 Antibody - BSA Free (NBP2-94224) is a polyclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 40-140 of human SLC22A11 (NP_060954.1). FSAAIPGHRCWTHMLDNGSAVSTNMTPKALLTISIPPGPNQGPHQCRRFRQPQWQLLDPNATATSWSEADTEPCVDGWVYDRSVFTSTIVAKWDLVCSSQG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC22A11
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SLC22A11 Antibody - BSA Free

• hOAT4
• MGC34282
• OAT4solute carrier family 22 (organic anion/cation transporter), member 11
• Organic anion transporter 4
• solute carrier family 22 (organic anion/urate transporter), member 11
• solute carrier family 22 member 11

Background

The protein encoded by the SLC22A11 gene is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and is found mainly in the kidney and in the placenta, where it may act to prevent potentially harmful organic anions from reaching the fetus. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC22A11