SLC22A1 Antibody

Images

 
Immunohistochemistry: SLC22A1 Antibody [NBP1-89418] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules and strong positivity in glomeruli.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC22A1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PRWLLSQKRNTEAIKIMDHIAQKNGKLPPADLKMLSLEEDVTEKLSPSFADLFRTPRLRKRTFIL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC22A1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:10 - 1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SLC22A1 Protein (NBP1-89418PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC22A1 Antibody

  • hOCT1
  • OCT1
  • oct1_cds
  • OCT1solute carrier family 22 member 1
  • Organic cation transporter 1
  • SLC22A1
  • solute carrier family 22 (organic cation transporter), member 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89417
Species: Hu, Rt
Applications: WB, IHC, IHC-P
H00005452-D01P
Species: Hu, Mu, Rt
Applications: WB
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-21584
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NB100-80870
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, ELISA, IHC, IHC-P
AF5486
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, CyTOF-ready, ICC
H00009356-M05
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB100-74482
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-87909
Species: Hu
Applications: IHC, IHC-P
NBP2-22124
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00006583-A01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-FrFl, IHC-WhMt
NBP2-57222
Species: Hu
Applications: ICC/IF
NBP1-62660
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-56965
Species: Hu
Applications: WB, ICC/IF
NB100-1607
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19388
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-36492
Species: Hu
Applications: Flow, IHC, IHC-P
NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
NBP1-89418
Species: Hu
Applications: IHC, IHC-P

Publications for SLC22A1 Antibody (NBP1-89418) (0)

There are no publications for SLC22A1 Antibody (NBP1-89418).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC22A1 Antibody (NBP1-89418) (0)

There are no reviews for SLC22A1 Antibody (NBP1-89418). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SLC22A1 Antibody (NBP1-89418) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC22A1 Products

Bioinformatics Tool for SLC22A1 Antibody (NBP1-89418)

Discover related pathways, diseases and genes to SLC22A1 Antibody (NBP1-89418). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC22A1 Antibody (NBP1-89418)

Discover more about diseases related to SLC22A1 Antibody (NBP1-89418).
 

Pathways for SLC22A1 Antibody (NBP1-89418)

View related products by pathway.

PTMs for SLC22A1 Antibody (NBP1-89418)

Learn more about PTMs related to SLC22A1 Antibody (NBP1-89418).

Blogs on SLC22A1

There are no specific blogs for SLC22A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC22A1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC22A1
Entrez