MATE1 Antibody


Immunohistochemistry-Paraffin: MATE1 Antibody [NBP1-87909] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: MATE1 Antibody [NBP1-87909] - Staining of human adrenal gland shows high expression.
Immunohistochemistry-Paraffin: MATE1 Antibody [NBP1-87909] - Staining in human adrenal gland and pancreas tissues using anti-SLC47A1 antibody. Corresponding SLC47A1 RNA-seq data are presented for the same tissues.

Product Details

Reactivity Hu, RtSpecies Glossary
Applications IHC, IHC-P

Order Details

MATE1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: HANLKVNNVPRSGNSALPQDPLHPGCPENLEGILTNDVGKTGEPQSDQQMRQEEPLPEHPQDGAKLSRKQ
Specificity of human MATE1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MATE1 Protein (NBP1-87909PEP)
Read Publication using
NBP1-87909 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 24887156).

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for MATE1 Antibody

  • hMATE-1
  • MATE-1
  • MATE1FLJ10847multidrug and toxin extrusion 1
  • MGC64822
  • multidrug and toxin extrusion protein 1
  • Solute carrier family 47 member 1
  • solute carrier family 47, member 1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Rt
Applications: WB, IHC, IHC-P, Single Cell Western
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
Species: Hu
Applications: IHC
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: IHC, IHC-P

Publications for MATE1 Antibody (NBP1-87909)(1)

We have publications tested in 1 confirmed species: Rat.

We have publications tested in 1 application: IHC.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for MATE1 Antibody (NBP1-87909) (0)

There are no reviews for MATE1 Antibody (NBP1-87909). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MATE1 Antibody (NBP1-87909) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MATE1 Antibody and receive a gift card or discount.


Gene Symbol SLC47A1