MATE1 Antibody

Images

 
Immunohistochemistry-Paraffin: MATE1 Antibody [NBP1-87909] - Staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells.
Orthogonal Strategies: Immunohistochemistry-Paraffin: MATE1 Antibody [NBP1-87909] - Analysis in human adrenal gland and pancreas tissues. Corresponding SLC47A1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: MATE1 Antibody [NBP1-87909] - Staining of human adrenal gland shows strong membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: MATE1 Antibody [NBP1-87909] - Staining of human kidney shows strong membranous positivity in cells in tubules.
Immunohistochemistry-Paraffin: MATE1 Antibody [NBP1-87909] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: MATE1 Antibody [NBP1-87909] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

MATE1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: HANLKVNNVPRSGNSALPQDPLHPGCPENLEGILTNDVGKTGEPQSDQQMRQEEPLPEHPQDGAKLSRKQ
Specificity
Specificity of human MATE1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC47A1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
IHC reported in scientific literature (PMID: 24887156). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MATE1 Protein (NBP1-87909PEP)
Publications
Read Publication using
NBP1-87909 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 24887156).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MATE1 Antibody

  • hMATE-1
  • MATE-1
  • MATE1FLJ10847multidrug and toxin extrusion 1
  • MGC64822
  • multidrug and toxin extrusion protein 1
  • Solute carrier family 47 member 1
  • solute carrier family 47, member 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89417
Species: Hu, Rt
Applications: WB, IHC, IHC-P, Single-Cell Western
NBP1-51684
Species: Hu, Mu
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC
NBP2-75734
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, PA
NBP2-21584
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00009376-B01P
Species: Hu, Rt
Applications: WB, IHC
NBP1-69368
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-97763
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB100-2379
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, Flow, ICC/IF, IHC
H00009356-M05
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NBP2-22124
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-42202
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NB100-1471
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
NB100-1607
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IP
NBP1-87909
Species: Hu, Rt
Applications: IHC, IHC-P

Publications for MATE1 Antibody (NBP1-87909)(1)

We have publications tested in 1 confirmed species: Rat.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Rat
(1)
All Species

Reviews for MATE1 Antibody (NBP1-87909) (0)

There are no reviews for MATE1 Antibody (NBP1-87909). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MATE1 Antibody (NBP1-87909) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MATE1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC47A1