![Immunohistochemistry-Paraffin: MATE1 Antibody [NBP1-87909] - Analysis in human adrenal gland and pancreas tissues. Corresponding SLC47A1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/MATE1-Antibody-Immunohistochemistry-Paraffin-NBP1-87909-img0008.jpg "Immunohistochemistry-Paraffin: MATE1 Antibody [NBP1-87909] - Analysis in human adrenal gland and pancreas tissues. Corresponding SLC47A1 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, RtSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit MATE1 Antibody - BSA Free (NBP1-87909) is a polyclonal antibody validated for use in IHC. Anti-MATE1 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: HANLKVNNVPRSGNSALPQDPLHPGCPENLEGILTNDVGKTGEPQSDQQMRQEEPLPEHPQDGAKLSRKQ |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SLC47A1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
| Publication using NBP1-87909 | Applications | Species |
|---|---|---|
| Shao R, Li X, Feng Y, Lin JF, Billig H. Direct effects of metformin in the endometrium: a hypothetical mechanism for the treatment of women with PCOS and endometrial carcinoma. J Exp Clin Cancer Res 2014-05-11 [PMID: 24887156] (IF/IHC, Rat) | IF/IHC | Rat |
Secondary Antibodies |
Isotype Controls |
Research Areas for MATE1 Antibody (NBP1-87909)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SLC47A1 |
![Immunohistochemistry-Paraffin: MATE1 Antibody [NBP1-87909] - Staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells.](http://images.novusbio.com/fullsize/MATE1-Antibody-Immunohistochemistry-Paraffin-NBP1-87909-img0012.jpg "Immunohistochemistry-Paraffin: MATE1 Antibody [NBP1-87909] - Staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells.")
![Immunohistochemistry-Paraffin: MATE1 Antibody [NBP1-87909] - Staining of human adrenal gland shows strong membranous positivity in glandular cells.](http://images.novusbio.com/fullsize/MATE1-Antibody-Immunohistochemistry-Paraffin-NBP1-87909-img0009.jpg "Immunohistochemistry-Paraffin: MATE1 Antibody [NBP1-87909] - Staining of human adrenal gland shows strong membranous positivity in glandular cells.")
![Immunohistochemistry-Paraffin: MATE1 Antibody [NBP1-87909] - Staining of human kidney shows strong membranous positivity in cells in tubules.](http://images.novusbio.com/fullsize/MATE1-Antibody-Immunohistochemistry-Paraffin-NBP1-87909-img0010.jpg "Immunohistochemistry-Paraffin: MATE1 Antibody [NBP1-87909] - Staining of human kidney shows strong membranous positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: MATE1 Antibody [NBP1-87909] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.](http://images.novusbio.com/fullsize/MATE1-Antibody-Immunohistochemistry-Paraffin-NBP1-87909-img0011.jpg "Immunohistochemistry-Paraffin: MATE1 Antibody [NBP1-87909] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.")
![Immunohistochemistry-Paraffin: MATE1 Antibody [NBP1-87909] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.](http://images.novusbio.com/fullsize/MATE1-Antibody-Immunohistochemistry-Paraffin-NBP1-87909-img0013.jpg "Immunohistochemistry-Paraffin: MATE1 Antibody [NBP1-87909] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.")
![Immunohistochemistry SLC22A2/OCT2 Antibody (640438) [Unconjugated]](https://images.novusbio.com/images2/SLC22A2_MAB6547_Immunohistochemistry_10365.jpg)
![Flow Cytometry SLC22A2/OCT2 Antibody (640438) [Unconjugated]](https://images.novusbio.com/images2/mab6547_human-slc22a2-oct2-mab-clone-640438-flow-cytometry-169202115433.jpg)
![Multiplex Immunofluorescence SLC22A2/OCT2 Antibody (640438) [Unconjugated]](https://images.novusbio.com/images/antibody/mab6547_human-slc22a2-oct2-mab-clone-640438-multiplex-immunofluorescence-15112024124421.jpg)
![Chromatin Immunoprecipitation (ChIP) Oct-3/4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Oct-3_4_AF1759_Chromatin_Immunoprecipitation_11218.jpg)
![Immunocytochemistry Oct-3/4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Oct-3_4_AF1759_Immunocytochemistry_7093.jpg)
![Simple Western Oct-3/4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Oct3_4_AF1759_Simple_Western_20183.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")