SLC16A4 Antibody - BSA Free

Western Blot: SLC16A4 Antibody [NBP2-93899] - Western blot analysis of extracts of SW480 cells, using SLC16A4 Rabbit pAb (NBP2-93899) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.

• Reactivity: Hu, Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SLC16A4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SLC16A4 Antibody - BSA Free (NBP2-93899) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 388-487 of human SLC16A4 (NP_004687.1). TFPLLMTYTICFAIFAGGYLALILPVLVDLCRNSTVNRFLGLASFFAGMAVLSGPPIAGWLYDYTQTYNGSFYFSGICYLLSSVSFFFVPLAERWKNSLT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC16A4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SLC16A4 Antibody - BSA Free

• MCT 5
• MCT 6
• MCT5
• MCT6
• Monocarboxylate transporter 5
• Monocarboxylic acid transporter 5
• Monocarboxylic acid transporter 6
• MOT5
• SLC16A4
• SLC16A5
• solute carrier family 16 (monocarboxylic acid transporters) member 5
• Solute carrier family 16 member 5

Background

Proton-linked monocarboxylate transporter. Catalyzes the rapid transport across the plasma membrane of many monocarboxylates such as lactate, pyruvate, branched-chain oxo acids derived from leucine, valine and isoleucine, and the ketone bodies acetoacetate, beta-hydroxybutyrate and acetate.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC16A4