MCT8/SLC16A2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: MCT8/SLC16A2 Antibody [NBP2-57308] - Staining of human cell line U-251 MG shows localization to plasma membrane. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: MCT8/SLC16A2 Antibody [NBP2-57308] - Staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.

Immunohistochemistry-Paraffin: MCT8/SLC16A2 Antibody [NBP2-57308] - Staining of mouse embryo E11 shows strong membranous positivity in the developing circumventricular organ.

Immunohistochemistry-Paraffin: MCT8/SLC16A2 Antibody [NBP2-57308] - Staining of human cerebral cortex shows moderate positivity in neuropil.

Immunohistochemistry-Paraffin: MCT8/SLC16A2 Antibody [NBP2-57308] - Staining of human kidney shows moderate membranous positivity in cells in tubules.

Immunohistochemistry-Paraffin: MCT8/SLC16A2 Antibody [NBP2-57308] - Staining of human liver shows moderate to strong membranous positivity in hepatocytes.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MCT8/SLC16A2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LMHQRMFKKEQRDSSKDKMLAPDPDPNGELLPGSPNPEEPI
• Predicted Species: Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC16A2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IHC-P Retrieval method: HIER pH6.
• Control Peptide:

  MCT8/SLC16A2 Recombinant Protein Antigen (NBP2-57308PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MCT8/SLC16A2 Antibody - BSA Free

• AHDS
• DXS128
• DXS128E
• MCT 7
• MCT 8
• MCT8
• MRX22
• SLC16A2
• solute carrier family 16, member 2 (monocarboxylic acid transporter 8)
• XPCT

Background

The SLC16A2 gene encodes an integral membrane protein transporter of thyroid hormone; specifically, cellular importation of thyroxine (T4), triiodothyronine (T3), reverse triiodothyronine (rT3) and diidothyronine (T2). This gene is expressed in many tissues incl

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MCT8/SLC16A2 Antibody (NBP2-57308)(6)

Publications using NBP2-57308

• Ueno M, Chiba Y, Murakami R et Al. Distribution of Monocarboxylate Transporters in Brain and Choroid Plexus Epithelium Pharmaceutics 2023-07-31 [PMID: 37631275] (Immunohistochemistry, Human)
• Wang Y, Wang T, Montero-Pedrazuela A et al. Thyroid Hormone Transporters MCT8 and OATP1C1 Are Expressed in Pyramidal Neurons and Interneurons in the Adult Motor Cortex of Human and Macaque Brain International journal of molecular sciences 2023-02-06 [PMID: 36834621]
• Graffunder AS, Paisdzior S, Opitz R Et al. Design and Characterization of a Fluorescent Reporter Enabling Live-cell Monitoring of MCT8 Expression Experimental and clinical endocrinology & diabetes : official journal, German Society of Endocrinology [and] German Diabetes Association 2021-08-05 [PMID: 34352913]
• T Porst, J Johannes, H Gluschke, R Köhler, S Mehl, P Kühnen, K Renko, WB Minich, S Wiegand, L Schomburg Natural Autoimmunity to the Thyroid Hormone Monocarboxylate Transporters MCT8 and MCT10 Biomedicines, 2021-04-30;9(5):. 2021-04-30 [PMID: 33946552] (Immunohistochemistry, Human)
• Wilpert NM, Krueger M, Opitz R et al. Spatiotemporal Changes of Cerebral Monocarboxylate Transporter 8 Expression Thyroid 2020-03-06 [PMID: 32143555] (IF/IHC, Human)
• Porst T Detection and physiological role of autoimmunity against thyroid hormone transporters Thesis 2022-01-01 (Human)

Bioinformatics

• Gene Symbol: SLC16A2