Immunocytochemistry/ Immunofluorescence: MCT8/SLC16A2 Antibody [NBP2-57308] - Staining of human cell line U-251 MG shows localization to plasma membrane. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: MCT8/SLC16A2 Antibody [NBP2-57308] - Staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.
Immunohistochemistry-Paraffin: MCT8/SLC16A2 Antibody [NBP2-57308] - Staining of mouse embryo E11 shows strong membranous positivity in the developing circumventricular organ.
Immunohistochemistry-Paraffin: MCT8/SLC16A2 Antibody [NBP2-57308] - Staining of human cerebral cortex shows moderate positivity in neuropil.
Immunohistochemistry-Paraffin: MCT8/SLC16A2 Antibody [NBP2-57308] - Staining of human kidney shows moderate membranous positivity in cells in tubules.
Immunohistochemistry-Paraffin: MCT8/SLC16A2 Antibody [NBP2-57308] - Staining of human liver shows moderate to strong membranous positivity in hepatocytes.
Expression of MCT8 and OATP1C1 in the cerebral barriers of the human and macaque motor cortex. Representative brightfield (A,E,I,M) and fluorescence confocal microscope (B–D,F–H,J–L,N–T) photomicrographs showing ...read more
Expression of MCT8 and OATP1C1 in the cerebral barriers of the human and macaque motor cortex. Representative brightfield (A,E,I,M) and fluorescence confocal microscope (B–D,F–H,J–L,N–T) photomicrographs showing ...read more
Expression of MCT8 in pyramidal neurons of the human and macaque motor cortex. Representative brightfield photomicrographs show immunostaining for MCT8 in layers III (A), V (B) and VI (C) of the human motor cortex, and ...read more
Expression of MCT8 in pyramidal neurons of the human and macaque motor cortex. Representative brightfield photomicrographs show immunostaining for MCT8 in layers III (A), V (B) and VI (C) of the human motor cortex, and ...read more
Expression of MCT8 and OATP1C1 in human and macaque motor cortex astrocytes. Representative brightfield (A–E,I) photomicrographs of sections immunostained for MCT8 (A,C) and OATP1C1 (B,D,E,I) in cortical layer I ...read more
Expression of MCT8 and OATP1C1 in the cerebral barriers of the human and macaque motor cortex. Representative brightfield (A,E,I,M) and fluorescence confocal microscope (B–D,F–H,J–L,N–T) photomicrographs showing ...read more
Expression of MCT8 and OATP1C1 in human and macaque motor cortex astrocytes. Representative brightfield (A–E,I) photomicrographs of sections immunostained for MCT8 (A,C) and OATP1C1 (B,D,E,I) in cortical layer I ...read more
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LMHQRMFKKEQRDSSKDKMLAPDPDPNGELLPGSPNPEEPI
Predicted Species
Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC16A2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified
Alternate Names for MCT8/SLC16A2 Antibody - BSA Free
AHDS
DXS128
DXS128E
MCT 7
MCT 8
MCT8
MRX22
SLC16A2
solute carrier family 16, member 2 (monocarboxylic acid transporter 8)
XPCT
Background
The SLC16A2 gene encodes an integral membrane protein transporter of thyroid hormone; specifically, cellular importation of thyroxine (T4), triiodothyronine (T3), reverse triiodothyronine (rT3) and diidothyronine (T2). This gene is expressed in many tissues incl
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our MCT8/SLC16A2 Antibody - BSA Free and receive a gift card or discount.