MCT8/SLC16A2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: MCT8/SLC16A2 Antibody [NBP2-57308] - Staining of human cell line U-251 MG shows localization to plasma membrane. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: MCT8/SLC16A2 Antibody [NBP2-57308] - Staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.
Immunohistochemistry-Paraffin: MCT8/SLC16A2 Antibody [NBP2-57308] - Staining of mouse embryo E11 shows strong membranous positivity in the developing circumventricular organ.
Immunohistochemistry-Paraffin: MCT8/SLC16A2 Antibody [NBP2-57308] - Staining of human cerebral cortex shows moderate positivity in neuropil.
Immunohistochemistry-Paraffin: MCT8/SLC16A2 Antibody [NBP2-57308] - Staining of human kidney shows moderate membranous positivity in cells in tubules.
Immunohistochemistry-Paraffin: MCT8/SLC16A2 Antibody [NBP2-57308] - Staining of human liver shows moderate to strong membranous positivity in hepatocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MCT8/SLC16A2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LMHQRMFKKEQRDSSKDKMLAPDPDPNGELLPGSPNPEEPI
Specificity
Specificity of human MCT8/SLC16A2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC16A2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IHC-P Retrieval method: HIER pH6.
Control Peptide
MCT8/SLC16A2 Recombinant Protein Antigen (NBP2-57308PEP)
Publications
Read Publication using
NBP2-57308 in the following applications:

  • IHC
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for MCT8/SLC16A2 Antibody

  • AHDS
  • DXS128
  • DXS128E
  • MCT 7
  • MCT 8
  • MCT8
  • MRX22
  • SLC16A2
  • solute carrier family 16, member 2 (monocarboxylic acid transporter 8)
  • XPCT

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80700
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-57642
Species: Hu
Applications: WB, IHC, IHC-P
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, Dual ISH-IHC, IHC-FrFl, IHC-WhMt, KO
NBP1-59656
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-00178
Species: Hu, Mu, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA
NBP2-95244
Species: Hu, Mu
Applications: WB, ICC/IF, IHC
NBP1-05767
Species: Hu, Mu, Rt, Ha, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
H00027349-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
AF3998
Species: Hu
Applications: WB
NBP1-47989
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-50465
Species: Hu
Applications: Flow, IHC, IHC-P, CyTOF-ready, Flow-CS
NBP1-88927
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13315
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-81251
Species: Hu, Mu
Applications: Simple Western, IB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-03626
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-85770
Species: Hu
Applications: WB, IHC, IHC-P
AF4066
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
NBP2-57308
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for MCT8/SLC16A2 Antibody (NBP2-57308)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for MCT8/SLC16A2 Antibody (NBP2-57308) (0)

There are no reviews for MCT8/SLC16A2 Antibody (NBP2-57308). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MCT8/SLC16A2 Antibody (NBP2-57308) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MCT8/SLC16A2 Products

Bioinformatics Tool for MCT8/SLC16A2 Antibody (NBP2-57308)

Discover related pathways, diseases and genes to MCT8/SLC16A2 Antibody (NBP2-57308). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MCT8/SLC16A2 Antibody (NBP2-57308)

Discover more about diseases related to MCT8/SLC16A2 Antibody (NBP2-57308).
 

Pathways for MCT8/SLC16A2 Antibody (NBP2-57308)

View related products by pathway.

PTMs for MCT8/SLC16A2 Antibody (NBP2-57308)

Learn more about PTMs related to MCT8/SLC16A2 Antibody (NBP2-57308).

Blogs on MCT8/SLC16A2

There are no specific blogs for MCT8/SLC16A2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MCT8/SLC16A2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC16A2