SLC16A6 Antibody

Images

 
Immunohistochemistry: SLC16A6 Antibody [NBP2-31578] - Staining of human heart muscle shows strong membranous positivity in myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC16A6 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PASPKIVIQENRKEAQYMLENEKTRTSIDSIDSGVELTTSPKNVPTHTNLELEPKADMQQVLVKTSPRPSEKKAPLL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC16A6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SLC16A6 Protein (NBP2-31578PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC16A6 Antibody

  • MCT6MCT 6
  • MCT7MCT 7
  • Monocarboxylate transporter 6
  • monocarboxylate transporter 7
  • solute carrier family 16 (monocarboxylic acid transporters), member 6
  • Solute carrier family 16 member 6
  • solute carrier family 16, member 6 (monocarboxylic acid transporter 7)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-59656
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13315
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-81251
Species: Hu
Applications: Simple Western, ICC/IF, IHC, IHC-P
NBP1-83936
Species: Hu
Applications: WB, IHC, IHC-P
AF3998
Species: Hu
Applications: WB
NBP2-03626
Species: Hu
Applications: WB, IHC, IHC-P
MAB4099
Species: Hu
Applications: WB, IP
NBP2-57308
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-87846
Species: Hu
Applications: WB, IHC, IHC-P
H00009121-R01
Species: Hu
NBP1-59885
Species: Hu, Mu
Applications: WB, IHC, IHC-P
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
AF972
Species: Hu
Applications: WB, Simple Western, IHC
NB300-133
Species: Hu, Mu, Rt, Po, Av, Bv, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-128
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P
NBP1-80700
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
AF5394
Species: Hu, Mu
Applications: WB
MAB35661
Species: Hu
Applications: WB, IHC, IP, Neut
NBP2-31578
Species: Hu
Applications: IHC, IHC-P

Publications for SLC16A6 Antibody (NBP2-31578) (0)

There are no publications for SLC16A6 Antibody (NBP2-31578).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC16A6 Antibody (NBP2-31578) (0)

There are no reviews for SLC16A6 Antibody (NBP2-31578). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SLC16A6 Antibody (NBP2-31578) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC16A6 Products

Bioinformatics Tool for SLC16A6 Antibody (NBP2-31578)

Discover related pathways, diseases and genes to SLC16A6 Antibody (NBP2-31578). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC16A6 Antibody (NBP2-31578)

Discover more about diseases related to SLC16A6 Antibody (NBP2-31578).
 

Pathways for SLC16A6 Antibody (NBP2-31578)

View related products by pathway.

PTMs for SLC16A6 Antibody (NBP2-31578)

Learn more about PTMs related to SLC16A6 Antibody (NBP2-31578).

Blogs on SLC16A6

There are no specific blogs for SLC16A6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC16A6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC16A6
Uniprot