MCT3/SLC16A8 Antibody

Western Blot: MCT3/SLC16A8 Antibody [NBP1-59885] - Jurkat cell lysate, Antibody Titration: 2.5ug/ml

Immunohistochemistry-Paraffin: MCT3/SLC16A8 Antibody [NBP1-59885] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.

Western Blot: MCT3/SLC16A8 Antibody [NBP1-59885] - analysis of MCT3 in porcine and mouse (far right lane) skeletal muscle lysates using anti-MCT3 antibody. Image from verified customer review.

• Reactivity: Hu, Mu
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

MCT3/SLC16A8 Antibody Summary

• Immunogen: Synthetic peptides corresponding to SLC16A8(solute carrier family 16, member 8 (monocarboxylic acid transporter 3)) The peptide sequence was selected from the middle region of SLC16A8. Peptide sequence RAFAVYAVTKFLMALGLFVPAILLVNYAKDAGVPDTDAAFLLSIVGFVDI The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC16A8
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml
• Application Notes: This is a rabbit polyclonal antibody against SLC16A8 and was validated on Western Blot and immunohistochemistry-paraffin
• Theoretical MW: 55 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MCT3/SLC16A8 Antibody

• MCT3
• MCT3MCT 3
• monocarboxylate transporter 3
• REMP
• SLC16A8
• solute carrier 16 (monocarboxylic acid transporters), member 8
• Solute carrier family 16 member 8
• solute carrier family 16, member 8 (monocarboxylic acid transporter 3)

Background

SLC16A8 is proton-linked monocarboxylate transporter. It catalyzes the rapid transport across the plasma membrane of many monocarboxylates such as lactate, pyruvate, branched-chain oxo acids derived from leucine, valine and isoleucine, and the ketone bodies acetoacetate, beta-hydroxybutyrate and acetate.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Review for MCT3/SLC16A8 Antibody (NBP1-59885) (1)

Average Rating: 4

(Based on 1 review)

We have 1 review tested in 1 species: Other.

reviewed by: Eric England WB Other 03/11/2015

Summary

• Application: Western Blot
• Sample Tested: Whole Skeletal Muscle Lysate
• Species: Other
• Lot: QC14101

Bioinformatics

• Gene Symbol: SLC16A8
• Uniprot:
  • O95907(Human)