MCT3/SLC16A8 Antibody

Images

 
Western Blot: MCT3/SLC16A8 Antibody [NBP1-59885] - Jurkat cell lysate, Antibody Titration: 2.5ug/ml
Immunohistochemistry-Paraffin: MCT3/SLC16A8 Antibody [NBP1-59885] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.
Western Blot: MCT3/SLC16A8 Antibody [NBP1-59885] - analysis of MCT3 in porcine and mouse (far right lane) skeletal muscle lysates using anti-MCT3 antibody. Image from verified customer review.

Product Details

Summary
Reactivity Hu, Mu, Rt, Ca, GpSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MCT3/SLC16A8 Antibody Summary

Immunogen
Synthetic peptides corresponding to SLC16A8(solute carrier family 16, member 8 (monocarboxylic acid transporter 3)) The peptide sequence was selected from the middle region of SLC16A8. Peptide sequence RAFAVYAVTKFLMALGLFVPAILLVNYAKDAGVPDTD The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Rat (93%), Canine (92%), Guinea Pig (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC16A8
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against SLC16A8 and was validated on Western Blot and immunohistochemistry-paraffin
Theoretical MW
55 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Reviewed Applications
Read 1 Review rated 4
using
NBP1-59885 in the following applications:

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MCT3/SLC16A8 Antibody

  • MCT3
  • MCT3MCT 3
  • monocarboxylate transporter 3
  • REMP
  • SLC16A8
  • solute carrier 16 (monocarboxylic acid transporters), member 8
  • Solute carrier family 16 member 8
  • solute carrier family 16, member 8 (monocarboxylic acid transporter 3)

Background

SLC16A8 is proton-linked monocarboxylate transporter. It catalyzes the rapid transport across the plasma membrane of many monocarboxylates such as lactate, pyruvate, branched-chain oxo acids derived from leucine, valine and isoleucine, and the ketone bodies acetoacetate, beta-hydroxybutyrate and acetate.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-59656
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-81251
Species: Hu, Mu
Applications: WB, Simple Western, IB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-13315
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-03626
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB300-877
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
AF3998
Species: Hu
Applications: WB
H00027349-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
AF972
Species: Hu
Applications: WB, Simple Western, ELISA, IHC, KO
NBP1-56853
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57308
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB110-39113
Species: Hu, Mu, Rt, Rb
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, Flow-IC
NBP1-59881
Species: Hu
Applications: WB
NBP1-80700
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-79286
Species: Rt
Applications: WB
MAB2005
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-57650
Species: Hu
Applications: WB
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-59885
Species: Hu, Mu, Rt, Ca, Gp
Applications: WB, IHC, IHC-P

Publications for MCT3/SLC16A8 Antibody (NBP1-59885) (0)

There are no publications for MCT3/SLC16A8 Antibody (NBP1-59885).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for MCT3/SLC16A8 Antibody (NBP1-59885) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Other.

Reviews using NBP1-59885:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Other
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot MCT3/SLC16A8 NBP1-59885
Enlarge
4
reviewed by:
Anonymous
WB Other 03/11/2015
View

Summary

ApplicationWestern Blot
Sample TestedWhole Skeletal Muscle Lysate
SpeciesOther
LotQC14101

Blocking

Blocking Details3% Casein in PBS with 0.1% Tween-20 for 1 hr

Primary Anitbody

Dilution Ratio1/2000 at 4C for 18 hr

Secondary Antibody

Secondary DescriptionDonkey anti-Rabbit IRDye 800CW - Licor Biosciences
Secondary Manufacturer Cat#926-32213
Secondary Concentration1/20,000

Details

Detection NotesLicor Odyssey

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MCT3/SLC16A8 Antibody (NBP1-59885) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MCT3/SLC16A8 Products

Bioinformatics Tool for MCT3/SLC16A8 Antibody (NBP1-59885)

Discover related pathways, diseases and genes to MCT3/SLC16A8 Antibody (NBP1-59885). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for MCT3/SLC16A8 Antibody (NBP1-59885)

View related products by pathway.

PTMs for MCT3/SLC16A8 Antibody (NBP1-59885)

Learn more about PTMs related to MCT3/SLC16A8 Antibody (NBP1-59885).

Blogs on MCT3/SLC16A8

There are no specific blogs for MCT3/SLC16A8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Anonymous
03/11/2015
Application: WB
Species: Other

Bioinformatics

Gene Symbol SLC16A8
Uniprot