Sirtuin 3/SIRT3 Antibody (7O4G7)

Immunohistochemistry-Paraffin: Sirtuin 3/SIRT3 Antibody (7O4G7) [NBP3-16083] - Immunohistochemistry of paraffin-embedded mouse kidney using [KO Validated] Sirtuin 3/SIRT3 Rabbit mAb (NBP3-16083) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Western Blot: Sirtuin 3/SIRT3 Antibody (7O4G7) [NBP3-16083] - Western blot analysis of lysates from wild type (WT) and Sirtuin 3/SIRT3 knockout (KO) 293T cells using [KO Validated] Sirtuin 3/SIRT3 Rabbit mAb at 1:1000 dilution incubated overnight at 4C.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.

Western Blot: Sirtuin 3/SIRT3 Antibody (7O4G7) [NBP3-16083] - Western blot analysis of various lysates using [KO Validated] Sirtuin 3/SIRT3 Rabbit mAb at 1:1000 dilution incubated overnight at 4C.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.

Immunoprecipitation: Sirtuin 3/SIRT3 Antibody (7O4G7) [NBP3-16083] - Immunoprecipitation analysis of 300ug extracts of Hela cells using 3ug Sirtuin 3/SIRT3 Rabbit mAb . Western blot was performed from the immunoprecipitate using Sirtuin 3/SIRT3 Rabbit mAb at a dilition of 1:1000.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC, IP, KO
• Clone: 7O4G7
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Sirtuin 3/SIRT3 Antibody (7O4G7) Summary

• Description: Novus Biologicals Knockout (KO) Validated Rabbit Sirtuin 3/SIRT3 Antibody (7O4G7) (NBP3-16083) is a recombinant monoclonal antibody validated for use in IHC, WB and IP. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 300-399 of human Sirtuin 3/SIRT3 (NP_036371.1). QRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLDGPDK
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: SIRT3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation 1:500 - 1:1000
  • Knockout Validated
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.09% Sodium Azide
• Purity: Affinity purified

Alternate Names for Sirtuin 3/SIRT3 Antibody (7O4G7)

• EC 3.5.1
• EC 3.5.1.-
• hSIRT3
• mitochondrial nicotinamide adenine dinucleotide-dependent deacetylase
• NAD-dependent deacetylase sirtuin-3, mitochondrial
• SIR2L3
• SIR2L3silent mating type information regulation 2, S.cerevisiae, homolog 3
• sir2-like 3
• SIR2-like protein 3
• SIRT3
• sirtuin (silent mating type information regulation 2 homolog) 3 (S. cerevisiae)
• sirtuin (silent mating type information regulation 2, S.cerevisiae, homolog) 3
• Sirtuin 3
• sirtuin type 3

Background

SIRT3 is expected to recognize both reported isoforms (NP_036371.1 and NP_001017524.1).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SIRT3