Mitofusin 2 Antibody (4H8)

Western Blot: Mitofusin 2 Antibody (4H8) [H00009927-M03] - Analysis of MFN2 expression in PC-12 (Cat # L012V1).

Immunohistochemistry-Paraffin: Mitofusin 2 Antibody (4H8) [H00009927-M03] - Analysis of monoclonal antibody to MFN2 on formalin-fixed paraffin-embedded human heart. Antibody concentration 5 ug/ml

Western Blot: Mitofusin 2 Antibody (4H8) [H00009927-M03] - Analysis of MFN2 over-expressed 293 cell line, cotransfected with MFN2 Validated Chimera RNAi ( Cat # H00009927-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with MFN2 monoclonal antibody (M03), clone 4H8 (Cat # H00009927-M03 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.

Western Blot: Mitofusin 2 Antibody (4H8) [H00009927-M03] - Analysis of MFN2 expression in HeLa (Cat # L013V1).

Western Blot: Mitofusin 2 Antibody (4H8) [H00009927-M03] - Analysis of MFN2 expression in transfected 293T cell line by MFN2 monoclonal antibody (M03), clone 4H8. Lane 1: MFN2 transfected lysatE (86.4 KDa). Lane 2: Non-transfected lysate.

ELISA: Mitofusin 2 Antibody (4H8) [H00009927-M03] - Detection limit for recombinant GST tagged MFN2 is approximately 1ng/ml as a capture antibody.

• Reactivity: Hu, Rt
• Applications: WB, ELISA, IHC, IHC-P, RNAi
• Clone: 4H8
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated

Mitofusin 2 Antibody (4H8) Summary

• Immunogen: MFN2 (NP_055689, 661 a.a. ~ 757 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FKRQFVEHASEKLQLVISYTGSNCSHQVQQELSGTFAHLCQQVDVTRENLEQEIAAMNKKIEVLDSLQSKAKLLRNKAGWLDSELNMFTHQYLQPSR
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: MFN2
• Purity: Ascites

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • RNA Inhibition
  • Western Blot

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Ascites

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Mitofusin 2 Antibody (4H8)

• CMT2A
• CMT2A2
• CPRP1
• CPRP1mitochondrial assembly regulatory factor
• EC 3.6.5
• EC 3.6.5.-
• HSG
• KIAA0214hyperplasia suppressor
• MARF
• MFN2
• Mitofusin 2
• mitofusin-2
• Transmembrane GTPase MFN2

Background

MFN2 encodes a mitochondrial membrane protein that participates in mitochondrial fusion and contributes to the maintenance and operation of the mitochondrial network. This protein is involved in the regulation of vascular smooth muscle cell proliferation, and it may play a role in the pathophysiology of obesity. Mutations in this gene cause Charcot-Marie-Tooth disease type 2A2, and hereditary motor and sensory neuropathy VI, which are both disorders of the peripheral nervous system. Defects in this gene have also been associated with early-onset stroke. Two transcript variants encoding the same protein have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Mitofusin 2 Antibody (H00009927-M03)(23)

Publications using H00009927-M03

• Zhou Q, Li H, Li Y et al. Inhibiting neddylation modification alters mitochondrial morphology and reprograms energy metabolism in cancer cells. JCI Insight. 2019-05-04 [PMID: 30668548]
• Ishikawa K, Yamamoto S, Hattori S et al. Acquired expression of mutant Mitofusin 2 causes progressive neurodegeneration and abnormal behavior. J Neurosci. 2019-02-03 [PMID: 30606759]
• Esteves AR, Palma AM, Gomes R et al. Acetylation as a major determinant to microtubule-dependent autophagy: Relevance to Alzheimer's and Parkinson disease pathology. Biochim Biophys Acta Mol Basis 2019-01-08 [PMID: 30572013]
• Desmoulins L, Chretien C, Paccoud R et al. Mitochondrial Dynamin-Related Protein 1 (DRP1) translocation in response to cerebral glucose is impaired in a rat model of early alteration in hypothalamic glucose sensing. Mol Metab. 2019-01-02 [PMID: 30553770]
• Larsen S, Lundby AM, Dandanell S et al. Four days of bed rest increases intrinsic mitochondrial respiratory capacity in young healthy males. Physiol Rep 2018-09-06 [PMID: 30221830]
• Basso V, Marchesan E, Peggion C et al. Regulation of Endoplasmic Reticulum-Mitochondria contacts by Parkin via Mfn2. Pharmacol Res 2018-09-13 [PMID: 30219582]
• Mattie S, Riemer J, Wideman JG et al. A new mitofusin topology places the redox-regulated C terminus in the mitochondrial intermembrane space. J Cell Biol 2017-12-06 [PMID: 29212658]
• Zhao YG, Chen Y, Miao G et al. The ER-Localized Transmembrane Protein EPG-3/VMP1 Regulates SERCA Activity to Control ER-Isolation Membrane Contacts for Autophagosome Formation. Mol Cell 2017-09-07 [PMID: 28890335]
• Nicassio L, Fracasso F, Sirago G et al. Dietary supplementation with acetyl-l-carnitine counteracts age-related alterations of mitochondrial biogenesis, dynamics and antioxidant defenses in brain of old rats. Exp Gerontol 2017-08-12 [PMID: 28807823]
• Thaher O, Wolf C, Dey PN et al. The thiol switch C684 in Mitofusin-2 mediates redox-induced alterations of mitochondrial shape and respiration. Neurochem Int 2017-05-17 [PMID: 28527631]
• Lundby C, Montero D, Gehrig S et al. Physiological, biochemical, anthropometric and biomechanical influences on exercise economy in humans. Scand J Med Sci Sports 2017-02-05 [PMID: 28164383]
• Silva DF, Esteves AR, Oliveira CR, Cardoso SM et al. Mitochondrial Metabolism Power SIRT2-Dependent Deficient Traffic Causing Alzheimer's-Disease Related Pathology. Mol Neurobiol 2016-06-17 [PMID: 27311773]
• Chen M, Chen Z, Wang Y et al. Mitophagy receptor FUNDC1 regulates mitochondrial dynamics and mitophagy. Autophagy 2016-04-02 [PMID: 27050458]
• Oettinghaus B, D'Alonzo D, Barbieri E et al. DRP1-dependent apoptotic mitochondrial fission occurs independently of BAX, BAK and APAF1 to amplify cell death by BID and oxidative stress. Biochim Biophys Acta 2016-03-17 [PMID: 26997499]
• Mignarri A, Rubegni A, Tessa A et al. Mitochondrial dysfunction in hereditary spastic paraparesis with mutations in DDHD1/SPG28. J Neurol Sci 2016-02-04 [PMID: 26944165]
• Jacobs RA, Lundby AM, Fenk S et al. Twenty-eight days of exposure to 3,454 m increases mitochondrial volume density in human skeletal muscle. J Physiol. 2015-09-04 [PMID: 26339730]
• Esteves AR, G-Fernandes M, Santos D et al. The Upshot of LRRK2 Inhibition to Parkinson's Disease Paradigm. Mol Neurobiol. 2014-11-15 [PMID: 25394383]
• Fiuza-Luces C, Delmiro A, Soares-Miranda L et al. Exercise training can induce cardiac autophagy at end-stage chronic conditions: Insights from a graft-versus-host-disease mouse model. Brain Behav Immun. 2013-11-14 [PMID: 24239952]
• Russell AP, Lamon S, Boon H et al. Regulation of miRNAs in human skeletal muscle following acute endurance exercise and short term endurance training. J Physiol. 2013-06-24 [PMID: 23798494]
• Lally JS, Herbst EA, Matravadia S et al. Over-expressing mitofusin-2 in healthy mature Mammalian skeletal muscle does not alter mitochondrial bioenergetics. PLoS One. 2013-01-31 [PMID: 23383258]
• Cosson P, Marchetti A, Ravazzola M, Orci L. Mitofusin-2 independent juxtaposition of endoplasmic reticulum and mitochondria: an ultrastructural study. PLoS One. 2012-09-28 [PMID: 23029466]
• Moran M, Rivera H, Sanchez-Arago M et al. Mitochondrial bioenergetics and dynamics interplay in complex i-deficient fibroblasts. Biochim Biophys Acta. 2010-02-11 [PMID: 20153825]
• Holloway GP, Perry CG, Thrush AB et al. PGC1{alpha} relationship with skeletal muscle palmitate oxidation is not present with obesity, despite maintained ained PGC1{alpha} and PGC1{beta} protein. Am J Physiol Endocrinol Metab 2008-03-18 [PMID: 18349111]

Review for Mitofusin 2 Antibody (H00009927-M03) (1)

Average Rating: 4

(Based on 1 review)

We have 1 review tested in 1 species: Rat.

reviewed by: Verified Customer Simple Western Rat 08/18/2017

Summary

• Application: Simple Western
• Sample Tested: cell line, whole cell lysate
• Species: Rat
• Lot: H7101-4H8

Bioinformatics

• Gene Symbol: MFN2