Mitofusin 2 Antibody (4H8)

Images

 
Western Blot: Mitofusin 2 Antibody (4H8) [H00009927-M03] - Analysis of MFN2 expression in PC-12 (Cat # L012V1).
Immunohistochemistry-Paraffin: Mitofusin 2 Antibody (4H8) [H00009927-M03] - Analysis of monoclonal antibody to MFN2 on formalin-fixed paraffin-embedded human heart. Antibody concentration 5 ug/ml
Western Blot: Mitofusin 2 Antibody (4H8) [H00009927-M03] - Analysis of MFN2 over-expressed 293 cell line, cotransfected with MFN2 Validated Chimera RNAi ( Cat # H00009927-R01V ) (Lane 2) or non-transfected control (Lane ...read more
Western Blot: Mitofusin 2 Antibody (4H8) [H00009927-M03] - Analysis of MFN2 expression in HeLa (Cat # L013V1).
Western Blot: Mitofusin 2 Antibody (4H8) [H00009927-M03] - Analysis of MFN2 expression in transfected 293T cell line by MFN2 monoclonal antibody (M03), clone 4H8. Lane 1: MFN2 transfected lysatE (86.4 KDa). Lane 2: ...read more
ELISA: Mitofusin 2 Antibody (4H8) [H00009927-M03] - Detection limit for recombinant GST tagged MFN2 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ELISA, IHC, IHC-P, RNAi, S-ELISA
Clone
4H8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Mitofusin 2 Antibody (4H8) Summary

Immunogen
MFN2 (NP_055689, 661 a.a. ~ 757 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FKRQFVEHASEKLQLVISYTGSNCSHQVQQELSGTFAHLCQQVDVTRENLEQEIAAMNKKIEVLDSLQSKAKLLRNKAGWLDSELNMFTHQYLQPSR
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MFN2
Purity
Ascites
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • RNA Inhibition
  • Sandwich ELISA
Reviewed Applications
Read 1 Review rated 4
using
H00009927-M03 in the following applications:

Publications
Read Publications using H00009927-M03.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
Ascites

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Mitofusin 2 Antibody (4H8)

  • CMT2A
  • CMT2A2
  • CPRP1
  • CPRP1mitochondrial assembly regulatory factor
  • EC 3.6.5
  • EC 3.6.5.-
  • HSG
  • KIAA0214hyperplasia suppressor
  • MARF
  • MFN2
  • Mitofusin 2
  • mitofusin-2
  • Transmembrane GTPase MFN2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-71775
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
NB110-55288
Species: Hu, Mu, Rt, Fi, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP
NB100-1607
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IP
NB100-57493
Species: Hu, Mu
Applications: WB, IP
NBP2-55414
Species: Hu
Applications: WB, ICC/IF
NB110-55290
Species: Hu, Mu, Rt, Po, Ch, Ze
Applications: WB, Simple Western, IB, IHC, IHC-P
NBP1-84074
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-2357
Species: Hu, Mu, Pm
Applications: WB, IHC, IHC-P, IP, ChIP
NBP2-02477
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-75449
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-67068
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-16148
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-53381
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr
NB100-56646
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-84430
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBL1-15012
Species: Hu
NBP1-28566
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, Flow, Func, IHC, IHC-Fr
NB100-56503
Species: Hu, Mu, Rt, Dr, Rb
Applications: WB, Simple Western, Flow, IB, ICC/IF, IHC, IHC-P, Flow-CS, Flow-IC

Publications for Mitofusin 2 Antibody (H00009927-M03)(23)


Showing Publications 1 - 10 of 23. Show All 23 Publications.
Publications using H00009927-M03 Applications Species
Zhou Q, Li H, Li Y et al. Inhibiting neddylation modification alters mitochondrial morphology and reprograms energy metabolism in cancer cells. JCI Insight. 2019 May 04 [PMID: 30668548]
Ishikawa K, Yamamoto S, Hattori S et al. Acquired expression of mutant Mitofusin 2 causes progressive neurodegeneration and abnormal behavior. J Neurosci. 2019 Feb 03 [PMID: 30606759]
Esteves AR, Palma AM, Gomes R et al. Acetylation as a major determinant to microtubule-dependent autophagy: Relevance to Alzheimer's and Parkinson disease pathology. Biochim Biophys Acta Mol Basis 2019 Jan 08 [PMID: 30572013]
Desmoulins L, Chretien C, Paccoud R et al. Mitochondrial Dynamin-Related Protein 1 (DRP1) translocation in response to cerebral glucose is impaired in a rat model of early alteration in hypothalamic glucose sensing. Mol Metab. 2019 Jan 02 [PMID: 30553770]
Larsen S, Lundby AM, Dandanell S et al. Four days of bed rest increases intrinsic mitochondrial respiratory capacity in young healthy males. Physiol Rep Sep 6 2018 [PMID: 30221830]
Basso V, Marchesan E, Peggion C et al. Regulation of Endoplasmic Reticulum-Mitochondria contacts by Parkin via Mfn2. Pharmacol Res Sep 13 2018 [PMID: 30219582]
Mattie S, Riemer J, Wideman JG et al. A new mitofusin topology places the redox-regulated C terminus in the mitochondrial intermembrane space. J Cell Biol Dec 6 2017 [PMID: 29212658]
Zhao YG, Chen Y, Miao G et al. The ER-Localized Transmembrane Protein EPG-3/VMP1 Regulates SERCA Activity to Control ER-Isolation Membrane Contacts for Autophagosome Formation. Mol Cell Sep 7 2017 [PMID: 28890335]
Nicassio L, Fracasso F, Sirago G et al. Dietary supplementation with acetyl-l-carnitine counteracts age-related alterations of mitochondrial biogenesis, dynamics and antioxidant defenses in brain of old rats. Exp Gerontol 2017 Aug 12 [PMID: 28807823]
Thaher O, Wolf C, Dey PN et al. The thiol switch C684 in Mitofusin-2 mediates redox-induced alterations of mitochondrial shape and respiration. Neurochem Int 2017 May 17 [PMID: 28527631]
Show All 23 Publications.

Review for Mitofusin 2 Antibody (H00009927-M03) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Rat.

Reviews using H00009927-M03:
Filter by Applications
Simple Western
(1)
All Applications
Filter by Species
Rat
(1)
All Species
Images Ratings Applications Species Date Details
Simple Western Mitofusin 2 H00009927-M03
Enlarge
reviewed by:
Julian Wong
Simple Western Rat 08/18/2017
View

Summary

ApplicationSimple Western
Sample Testedcell line, whole cell lysate
SpeciesRat
LotH7101-4H8

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Mitofusin 2 Antibody (H00009927-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Mitofusin 2 Products

Bioinformatics Tool for Mitofusin 2 Antibody (H00009927-M03)

Discover related pathways, diseases and genes to Mitofusin 2 Antibody (H00009927-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Mitofusin 2 Antibody (H00009927-M03)

Discover more about diseases related to Mitofusin 2 Antibody (H00009927-M03).
 

Pathways for Mitofusin 2 Antibody (H00009927-M03)

View related products by pathway.

PTMs for Mitofusin 2 Antibody (H00009927-M03)

Learn more about PTMs related to Mitofusin 2 Antibody (H00009927-M03).

Blogs on Mitofusin 2

There are no specific blogs for Mitofusin 2, but you can read our latest blog posts.
Coronavirus Brochure

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Julian Wong
08/18/2017
Application: Simple Western
Species: Rat

Bioinformatics

Gene Symbol MFN2