Novus Biologicals products are now on bio-techne.com

Mitofusin 2 Antibody (4H8)

Images

 
Western Blot: Mitofusin 2 Antibody (4H8) [H00009927-M03] - Analysis of MFN2 expression in PC-12 (Cat # L012V1).
Immunohistochemistry-Paraffin: Mitofusin 2 Antibody (4H8) [H00009927-M03] - Analysis of monoclonal antibody to MFN2 on formalin-fixed paraffin-embedded human heart. Antibody concentration 5 ug/ml
Western Blot: Mitofusin 2 Antibody (4H8) [H00009927-M03] - Analysis of MFN2 over-expressed 293 cell line, cotransfected with MFN2 Validated Chimera RNAi ( Cat # H00009927-R01V ) (Lane 2) or non-transfected control (Lane ...read more
Western Blot: Mitofusin 2 Antibody (4H8) [H00009927-M03] - Analysis of MFN2 expression in HeLa (Cat # L013V1).
Western Blot: Mitofusin 2 Antibody (4H8) [H00009927-M03] - Analysis of MFN2 expression in transfected 293T cell line by MFN2 monoclonal antibody (M03), clone 4H8. Lane 1: MFN2 transfected lysatE (86.4 KDa). Lane 2: ...read more
ELISA: Mitofusin 2 Antibody (4H8) [H00009927-M03] - Detection limit for recombinant GST tagged MFN2 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ELISA, IHC, KD
Clone
4H8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Mitofusin 2 Antibody (4H8) Summary

Immunogen
MFN2 (NP_055689, 661 a.a. ~ 757 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FKRQFVEHASEKLQLVISYTGSNCSHQVQQELSGTFAHLCQQVDVTRENLEQEIAAMNKKIEVLDSLQSKAKLLRNKAGWLDSELNMFTHQYLQPSR
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MFN2
Purity
Ascites
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • RNA Inhibition
  • Western Blot
Reviewed Applications
Read 1 Review rated 4
using
H00009927-M03 in the following applications:

Publications
Read Publications using H00009927-M03.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
Ascites

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Mitofusin 2 Antibody (4H8)

  • CMT2A
  • CMT2A2
  • CPRP1
  • CPRP1mitochondrial assembly regulatory factor
  • EC 3.6.5
  • EC 3.6.5.-
  • HSG
  • KIAA0214hyperplasia suppressor
  • MARF
  • MFN2
  • Mitofusin 2
  • mitofusin-2
  • Transmembrane GTPase MFN2

Background

MFN2 encodes a mitochondrial membrane protein that participates in mitochondrial fusion and contributes to the maintenance and operation of the mitochondrial network. This protein is involved in the regulation of vascular smooth muscle cell proliferation, and it may play a role in the pathophysiology of obesity. Mutations in this gene cause Charcot-Marie-Tooth disease type 2A2, and hereditary motor and sensory neuropathy VI, which are both disorders of the peripheral nervous system. Defects in this gene have also been associated with early-onset stroke. Two transcript variants encoding the same protein have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00055669-M04
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IP, KD, WB
NB110-55288
Species: Fi, Hu, Mu, Pm, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NB100-1607
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IP, WB
NB100-57493
Species: Hu, Mu
Applications: IP, WB
NBP3-21685
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NB110-55290
Species: Ch, Hu, Mu, Po, Rt, Ze
Applications: IB, ICC/IF, IHC, IHC-P, Simple Western, WB
H00007402-M01
Species: Hu
Applications: ELISA, ICC/IF, WB
NB100-2357
Species: Hu, Mu, Pm
Applications: ChIP, IHC, IHC-P, IP, WB
NBP2-02477
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP1-76982
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-67068
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-16148
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-53381
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, WB
NBP1-85664
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-84430
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBL1-15012
Species: Hu
Applications: WB
AF820
Species: Hu, Mu
Applications: ICC, IHC, KO, Simple Western, WB
NB100-56503
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB

Publications for Mitofusin 2 Antibody (H00009927-M03)(40)


Showing Publications 1 - 10 of 40. Show All 40 Publications.
Publications using H00009927-M03 Applications Species
Deepaneeta S, Abhishek S, Aishika D et al. Cardiolipin-Mediated Alleviation of Mitochondrial Dysfunction Is a Neuroprotective Effect of Statin in Animal Model of Ischemic Stroke. ACS Chem Neurosci. 2023-01-27 [PMID: 36706354]
Michael K, Liliana R, Maryam G et al. Chronic social stress disrupts the intracellular redistribution of brain hexokinase 3 induced by shifts in peripheral glucose levels. J Mol Med (Berl). 2022-08-09 [PMID: 35943566]
Christina W, Alireza P, Sara B et al. GDAP1 loss of function inhibits the mitochondrial pyruvate dehydrogenase complex by altering the actin cytoskeleton. Commun Biol. 2022-06-03 [PMID: 35662277]
Rosella S, Francesca A, Consiglia P et al. Myoglobin expression by alternative transcript in different mesenchymal stem cells compartments. Stem Cell Res Ther. 2022-05-21 [PMID: 35598009]
James S, Tina F, Yan Z et al. Vmp1, Vps13D, and Marf/Mfn2 function in a conserved pathway to regulate mitochondria and ER contact in development and disease. Curr Biol. 2021-05-20 [PMID: 34019822]
R Peruzzo, S Corrà, R Costa, M Brischigli, T Varanita, L Biasutto, C Rampazzo, D Ghezzi, L Leanza, M Zoratti, M Zeviani, C De Pittà, C Viscomi, R Costa, I Szabò Exploiting pyocyanin to treat mitochondrial disease due to respiratory complex III dysfunction Nature Communications, 2021-04-08;12(1):2103. 2021-04-08 [PMID: 33833234]
Guglielmina C, Anna P, Flavio F et al. The Age-Sensitive Efficacy of Calorie Restriction on Mitochondrial Biogenesis and mtDNA Damage in Rat Liver. Int J Mol Sci. 2021-02-07 [PMID: 33562258]
Ota A, Ishihara T, Ishihara N et al. Mitochondrial nucleoid morphology and respiratory function are altered in Drp1-deficient HeLa cells. J Biochem. 2019-12-24 [PMID: 31873747]
Faustini G, Marchesan E, Zonta L et al. Alpha-Synuclein Preserves Mitochondrial Fusion and Function in Neuronal Cells. Oxid Med Cell Longev. 2019-11-23 [PMID: 31871549]
Antonucci S, Di M, Sileikyte J et al. A novel class of cardioprotective small-molecule PTP inhibitors. Pharmacol Res. 2019-11-20 [PMID: 31759087]
Show All 40 Publications.

Review for Mitofusin 2 Antibody (H00009927-M03) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Rat.

Reviews using H00009927-M03:
Filter by Applications
Simple Western
(1)
All Applications
Filter by Species
Rat
(1)
All Species
Images Ratings Applications Species Date Details
Simple Western Mitofusin 2 H00009927-M03
Enlarge
4
reviewed by:
Julian Wong
Simple Western Rat 08/18/2017
View

Summary

ApplicationSimple Western
Sample Testedcell line, whole cell lysate
SpeciesRat
LotH7101-4H8

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Mitofusin 2 Antibody (H00009927-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Mitofusin 2 Products

Research Areas for Mitofusin 2 Antibody (H00009927-M03)

Find related products by research area.

Blogs on Mitofusin 2

There are no specific blogs for Mitofusin 2, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Julian Wong
08/18/2017
Application: Simple Western
Species: Rat

Bioinformatics

Gene Symbol MFN2