Mitofusin 2 Antibody (4H8)

Images

 
Western Blot: Mitofusin 2 Antibody (4H8) [H00009927-M03] - Analysis of MFN2 expression in PC-12 (Cat # L012V1).
Immunohistochemistry-Paraffin: Mitofusin 2 Antibody (4H8) [H00009927-M03] - Analysis of monoclonal antibody to MFN2 on formalin-fixed paraffin-embedded human heart. Antibody concentration 5 ug/ml
Western Blot: Mitofusin 2 Antibody (4H8) [H00009927-M03] - Analysis of MFN2 over-expressed 293 cell line, cotransfected with MFN2 Validated Chimera RNAi ( Cat # H00009927-R01V ) (Lane 2) or non-transfected control (Lane ...read more
Western Blot: Mitofusin 2 Antibody (4H8) [H00009927-M03] - Analysis of MFN2 expression in HeLa (Cat # L013V1).
Western Blot: Mitofusin 2 Antibody (4H8) [H00009927-M03] - Analysis of MFN2 expression in transfected 293T cell line by MFN2 monoclonal antibody (M03), clone 4H8. Lane 1: MFN2 transfected lysatE (86.4 KDa). Lane 2: ...read more
ELISA: Mitofusin 2 Antibody (4H8) [H00009927-M03] - Detection limit for recombinant GST tagged MFN2 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ELISA, IHC, IHC-P
Clone
4H8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Mitofusin 2 Antibody (4H8) Summary

Immunogen
MFN2 (NP_055689, 661 a.a. ~ 757 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FKRQFVEHASEKLQLVISYTGSNCSHQVQQELSGTFAHLCQQVDVTRENLEQEIAAMNKKIEVLDSLQSKAKLLRNKAGWLDSELNMFTHQYLQPSR
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MFN2
Purity
Ascites
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
Reviewed Applications
Read 1 Review rated 4
using
H00009927-M03 in the following applications:

Publications
Read Publications using
H00009927-M03 in the following applications:

  • WB
    2 publications

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
Ascites with PBS (pH 7.4)
Preservative
No Preservative
Purity
Ascites

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Mitofusin 2 Antibody (4H8)

  • CMT2A
  • CMT2A2
  • CPRP1
  • CPRP1mitochondrial assembly regulatory factor
  • EC 3.6.5
  • EC 3.6.5.-
  • HSG
  • KIAA0214hyperplasia suppressor
  • MARF
  • MFN2
  • Mitofusin 2
  • mitofusin-2
  • Transmembrane GTPase MFN2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-71775
Species: Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-55288
Species: Hu, Mu, Rt, Fi, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP
NB100-1607
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-57493
Species: Hu, Mu
Applications: WB, IP
NBP2-55414
Species: Hu
Applications: WB, ICC/IF
NB110-55290
Species: Hu, Mu, Rt, Po, Ch
Applications: WB, Simple Western, IHC, IHC-P
NBP1-84074
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-2357
Species: Hu, Mu, Pm
Applications: WB, IHC, IHC-P, IP
NBP2-02477
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-75449
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB110-59086
Species: Hu, Pm, Bv(-), Mu(-), Rt(-)
Applications: WB, IHC, IHC-P
NBP2-13913
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-53384
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC-P
NB100-56646
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
NBP1-84430
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBL1-15012
Species: Hu
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, Flow-IC

Publications for Mitofusin 2 Antibody (H00009927-M03)(17)

We have publications tested in 2 confirmed species: Human, Monkey.

We have publications tested in 1 application: WB.


Filter By Application
WB
(2)
All Applications
Filter By Species
Human
(1)
Monkey
(1)
All Species
Showing Publications 1 - 10 of 17. Show All 17 Publications.
Publications using H00009927-M03 Applications Species
Mattie S, Riemer J, Wideman JG et al. A new mitofusin topology places the redox-regulated C terminus in the mitochondrial intermembrane space. J Cell Biol. 2017 Dec 06 [PMID: 29212658] (WB, Human) WB Human
Zhao YG, Chen Y, Miao G et al. The ER-Localized Transmembrane Protein EPG-3/VMP1 Regulates SERCA Activity to Control ER-Isolation Membrane Contacts for Autophagosome Formation. Molecular Cell 2017 Sep 07 [PMID: 28890335] (WB, Monkey) WB Monkey
Nicassio L, Fracasso F, Sirago G et al. Dietary supplementation with acetyl-l-carnitine counteracts age-related alterations of mitochondrial biogenesis, dynamics and antioxidant defenses in brain of old rats. Exp Gerontol 2017 Aug 12 [PMID: 28807823]
Thaher O, Wolf C, Dey PN et al. The thiol switch C684 in Mitofusin-2 mediates redox-induced alterations of mitochondrial shape and respiration. Neurochem Int 2017 May 17 [PMID: 28527631]
Lundby C, Montero D, Gehrig S et al. Physiological, biochemical, anthropometric and biomechanical influences on exercise economy in humans. Scand J Med Sci Sports 2017 Feb 5 [PMID: 28164383]
Silva DF, Esteves AR, Oliveira CR, Cardoso SM et al. Mitochondrial Metabolism Power SIRT2-Dependent Deficient Traffic Causing Alzheimer's-Disease Related Pathology. Mol Neurobiol 2016 Jun 17 [PMID: 27311773]
Chen M, Chen Z, Wang Y et al. Mitophagy receptor FUNDC1 regulates mitochondrial dynamics and mitophagy. Autophagy 2016 Apr 2 [PMID: 27050458]
Oettinghaus B, D'Alonzo D, Barbieri E et al. DRP1-dependent apoptotic mitochondrial fission occurs independently of BAX, BAK and APAF1 to amplify cell death by BID and oxidative stress. Biochim Biophys Acta 2016 Mar 17 [PMID: 26997499]
Mignarri A, Rubegni A, Tessa A et al. Mitochondrial dysfunction in hereditary spastic paraparesis with mutations in DDHD1/SPG28. J Neurol Sci 2016 Feb 4 [PMID: 26944165]
Jacobs RA, Lundby AM, Fenk S et al. Twenty-eight days of exposure to 3,454 m increases mitochondrial volume density in human skeletal muscle. J Physiol. 2015 Sep 04 [PMID: 26339730]
Show All 17 Publications.

Review for Mitofusin 2 Antibody (H00009927-M03) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Rat.

Reviews using H00009927-M03:
Filter by Applications
Simple Western
(1)
All Applications
Filter by Species
Rat
(1)
All Species
Images Ratings Applications Species Date Details
Simple Western Mitofusin 2 H00009927-M03
Enlarge
reviewed by:
Julian Wong
Simple Western Rat 08/18/2017
View

Summary

ApplicationSimple Western
Sample Testedcell line, whole cell lysate
SpeciesRat
LotH7101-4H8

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Mitofusin 2 Antibody (H00009927-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Mitofusin 2 Antibody (H00009927-M03)

Discover related pathways, diseases and genes to Mitofusin 2 Antibody (H00009927-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Mitofusin 2 Antibody (H00009927-M03)

Discover more about diseases related to Mitofusin 2 Antibody (H00009927-M03).
 

Pathways for Mitofusin 2 Antibody (H00009927-M03)

View related products by pathway.

PTMs for Mitofusin 2 Antibody (H00009927-M03)

Learn more about PTMs related to Mitofusin 2 Antibody (H00009927-M03).

Blogs on Mitofusin 2

There are no specific blogs for Mitofusin 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Julian Wong
08/18/2017
Application: Simple Western
Species: Rat

Bioinformatics

Gene Symbol MFN2
Entrez