Sirtuin 5/SIRT5 Antibody

Images

 
Western Blot: Sirtuin 5/SIRT5 Antibody [NBP1-89535] - Analysis in human cell line EFO-21.
Immunocytochemistry/ Immunofluorescence: Sirtuin 5/SIRT5 Antibody [NBP1-89535] - Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.
Immunohistochemistry-Paraffin: Sirtuin 5/SIRT5 Antibody [NBP1-89535] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Sirtuin 5/SIRT5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:IDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVW
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SIRT5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Sirtuin 5/SIRT5 Protein (NBP1-89535PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Sirtuin 5/SIRT5 Antibody

  • EC 3.5.1
  • EC 3.5.1.-
  • FLJ36950
  • NAD-dependent deacetylase sirtuin-5
  • silent mating type information regulation 2, S.cerevisiae, homolog 5
  • SIR2L5
  • sir2-like 5
  • SIR2-like protein 5
  • SIRT5
  • sirtuin (silent mating type information regulation 2 homolog) 5 (S. cerevisiae)
  • sirtuin (silent mating type information regulation 2, S.cerevisiae, homolog) 5
  • Sirtuin 5
  • sirtuin type 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31029
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-51641
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-1923
Species: Ce
Applications: WB, IHC, IHC-P, IP
NB100-1406
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB100-2522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-52565
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC
NBP2-03993
Species: Hu, Bv, Ca, Pm
Applications: WB, IHC, IHC-P
NB300-270
Species: Hu, Mu, Rt, Ch
Applications: WB, Simple Western, ICC/IF, IP, In vitro
NBP1-86019
Species: Hu, Ca
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13893
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-05354
Species: Hu
H00007001-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBL1-11569
Species: Hu
NBP1-90276
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB6158
Species: Hu, Mu
Applications: WB, Simple Western, ICC
NBP2-56930
Species: Hu
Applications: ICC/IF
NBP1-04676
Species: Hu, Mu, Rt, Ha, Sq
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB21-2024
Species: Hu, Mu, Rt, Ma
Applications: WB, ChIP, DB, ICC/IF
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE

Publications for Sirtuin 5/SIRT5 Antibody (NBP1-89535) (0)

There are no publications for Sirtuin 5/SIRT5 Antibody (NBP1-89535).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Sirtuin 5/SIRT5 Antibody (NBP1-89535) (0)

There are no reviews for Sirtuin 5/SIRT5 Antibody (NBP1-89535). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Sirtuin 5/SIRT5 Antibody (NBP1-89535) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Sirtuin 5/SIRT5 Products

Bioinformatics Tool for Sirtuin 5/SIRT5 Antibody (NBP1-89535)

Discover related pathways, diseases and genes to Sirtuin 5/SIRT5 Antibody (NBP1-89535). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Sirtuin 5/SIRT5 Antibody (NBP1-89535)

Discover more about diseases related to Sirtuin 5/SIRT5 Antibody (NBP1-89535).
 

Pathways for Sirtuin 5/SIRT5 Antibody (NBP1-89535)

View related products by pathway.

PTMs for Sirtuin 5/SIRT5 Antibody (NBP1-89535)

Learn more about PTMs related to Sirtuin 5/SIRT5 Antibody (NBP1-89535).
 

Research Areas for Sirtuin 5/SIRT5 Antibody (NBP1-89535)

Find related products by research area.

Blogs on Sirtuin 5/SIRT5

There are no specific blogs for Sirtuin 5/SIRT5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Sirtuin 5/SIRT5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SIRT5
Entrez