Sirtuin 5/SIRT5 Antibody - BSA Free

Western Blot: Sirtuin 5/SIRT5 Antibody [NBP1-89535] - Analysis in human cell line EFO-21.

Immunocytochemistry/Immunofluorescence: Sirtuin 5/SIRT5 Antibody [NBP1-89535] - Staining of human cell line A-431 shows localization to mitochondria. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Sirtuin 5/SIRT5 Antibody [NBP1-89535] - Staining of human testis shows strong granular positivity in cytoplasm in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: Sirtuin 5/SIRT5 Antibody [NBP1-89535] - Staining of human cerebral cortex shows moderate granular positivity in cytoplasm in neurons.

Immunohistochemistry-Paraffin: Sirtuin 5/SIRT5 Antibody [NBP1-89535] - Staining of human duodenum shows strong granular positivity in cytoplasm in glandular cells.

Immunohistochemistry-Paraffin: Sirtuin 5/SIRT5 Antibody [NBP1-89535] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Sirtuin 5/SIRT5 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: IDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVW
• Predicted Species: Mouse (91%), Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SIRT5
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Sirtuin 5/SIRT5 Protein (NBP1-89535PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Sirtuin 5/SIRT5 Antibody - BSA Free

• EC 3.5.1
• EC 3.5.1.-
• FLJ36950
• NAD-dependent deacetylase sirtuin-5
• silent mating type information regulation 2, S.cerevisiae, homolog 5
• SIR2L5
• sir2-like 5
• SIR2-like protein 5
• SIRT5
• sirtuin (silent mating type information regulation 2 homolog) 5 (S. cerevisiae)
• sirtuin (silent mating type information regulation 2, S.cerevisiae, homolog) 5
• Sirtuin 5
• sirtuin type 5

Background

SIRT5 encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class III of the sirtuin family. Alternative splicing of this gene results in two transcript variants.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SIRT5