Siglec-7/CD328 Antibody - BSA Free

Western Blot: Siglec-7/CD328 Antibody [NBP1-59244] - 721_B cell lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Siglec-7/CD328 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to SIGLEC7(sialic acid binding Ig-like lectin 7) The peptide sequence was selected from the middle region of SIGLEC7. Peptide sequence WRSLTLYPSQPSNPLVLELQVHLGDEGEFTCRAQNSLGSQHVSLNLSLQQ. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SIGLEC7
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Siglec-7/CD328 Antibody - BSA Free

• Adhesion inhibitory receptor molecule 1
• adhesion inhibitory receptor molecule 1, siglec-7
• AIRM1
• AIRM-1
• AIRM1QA79 membrane protein
• CD328 antigen
• CD328
• CDw328
• D-siglec
• p75
• p75/AIRM1
• QA79
• sialic acid binding Ig-like lectin 7
• sialic acid binding immunoglobulin-like lectin 7
• sialic acid-binding Ig-like lectin 7
• Siglec7
• Siglec-7

Background

SIGLEC7 is a putative adhesion molecule that mediates sialic-acid dependent binding to cells. In the immune response, it may act as an inhibitory receptor upon ligand induced tyrosine phosphorylation by recruiting cytoplasmic phosphatase(s) via their SH2 domain(s) that block signal transduction through dephosphorylation of signaling molecules. SIGLEC7 mediates inhibition of natural killer cells cytotoxicity. It may also play a role in hemopoiesis. SIGLEC7 inhibits differentiation of CD34+ cell precursors towards myelomonocytic cell lineage and proliferation of leukemic myeloid cells (in vitro).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SIGLEC7
• Uniprot:
  • Q9Y286()