SH2D1A Antibody - BSA Free Summary
| Description |
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen |
Synthetic peptide directed towards the C terminal of human SH2D1A. Peptide sequence YFRKIKNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGIREDPDVCL. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
SH2D1A |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Theoretical MW |
14 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for SH2D1A Antibody - BSA Free
Background
The cytoplasmic protein encoded by the SH2D1A gene plays an essential role in controlling EBV infection. It is expressed in T and NK cells, but not in B cells or in granulocytes. SH2D1A is expressed at a high level in thymus and lung, with a lower level of expression in spleen and liver. Defects in SH2D1A are a cause of X-linked lymphoproliferative disease (XLPD)also known as Duncan disease. XLPD is characterized by an immunodeficiency following Epstein-Barr virus (EBV)infection. Symptoms include fatal mononucleosis, hypogammaglobulinemia, pancytopenia or malignant lymphoma.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, WB
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: AgAct, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, IHC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
Species: Mu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Mu
Applications: Simple Western, WB
Species: Hu
Applications: WB
Publications for SH2D1A/SAP Antibody (NBP1-79810) (0)
There are no publications for SH2D1A/SAP Antibody (NBP1-79810).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SH2D1A/SAP Antibody (NBP1-79810) (0)
There are no reviews for SH2D1A/SAP Antibody (NBP1-79810).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for SH2D1A/SAP Antibody (NBP1-79810) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional SH2D1A Products
Research Areas for SH2D1A/SAP Antibody (NBP1-79810)
Find related products by research area.
|
Blogs on SH2D1A