Aspartyl Aminopeptidase Antibody - BSA Free

Western Blot: Aspartyl Aminopeptidase Antibody [NBP1-91684] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-49

Immunohistochemistry-Paraffin: Aspartyl Aminopeptidase Antibody [NBP1-91684] - Staining of human cerebral cortex.

Immunohistochemistry-Paraffin: Aspartyl Aminopeptidase Antibody [NBP1-91684] - Staining of human liver shows strong nuclear positivity in hepatocytes.

Immunohistochemistry-Paraffin: Aspartyl Aminopeptidase Antibody [NBP1-91684] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry-Paraffin: Aspartyl Aminopeptidase Antibody [NBP1-91684] - Staining of human testis shows high expression.

Immunohistochemistry-Paraffin: Aspartyl Aminopeptidase Antibody [NBP1-91684] - Staining of human cerebral cortex, lymph node, pancreas and testis using Anti-DNPEP antibody NBP1-91684 (A) shows similar protein distribution across tissues to independent antibody NBP1-91685 (B).

Immunohistochemistry-Paraffin: Aspartyl Aminopeptidase Antibody [NBP1-91684] - Staining of human lymph node.

Analysis in human testis and pancreas tissues using Anti-DNPEP antibody. Corresponding DNPEP RNA-seq data are presented for the same tissues.

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Aspartyl Aminopeptidase Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Aspartyl Aminopeptidase Antibody - BSA Free (NBP1-91684) is a polyclonal antibody validated for use in IHC and WB. Anti-Aspartyl Aminopeptidase Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SCFCALQALIDSCAGPGSLATEPHVRMVTLYDNEEVGSESAQGAQSLLTELVLRRISASCQHPTAFEEAIPKSFMISADMAHAVHPNYLD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DNPEP
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Aspartyl Aminopeptidase Protein (NBP1-91684PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24743550)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Aspartyl Aminopeptidase Antibody - BSA Free

• aspartyl aminopeptidase
• ASPEPDAPEC 3.4.11.21

Background

Aspartyl Aminopeptidase is encoded by this gene is an aminopeptidase which prefers acidic amino acids, and specifically favors aspartic acid over glutamic acid. It is thought to be a cytosolic protein involved in general metabolism of intracellular proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Aspartyl Aminopeptidase Antibody (NBP1-91684)(1)

Publication using NBP1-91684

• Bachmann J, Burte F, Pramana S et al. Affinity Proteomics Reveals Elevated Muscle Proteins in Plasma of Children with Cerebral Malaria. PLoS Pathog 2014-04-01 [PMID: 24743550]

Bioinformatics

• Gene Symbol: DNPEP