Aspartyl Aminopeptidase Antibody

Images

 
Western Blot: Aspartyl Aminopeptidase Antibody [NBP1-91684] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-49
Immunohistochemistry-Paraffin: Aspartyl Aminopeptidase Antibody [NBP1-91684] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: Aspartyl Aminopeptidase Antibody [NBP1-91684] - Staining of human liver shows strong nuclear positivity in hepatocytes.
Immunohistochemistry-Paraffin: Aspartyl Aminopeptidase Antibody [NBP1-91684] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: Aspartyl Aminopeptidase Antibody [NBP1-91684] - Staining in human testis and pancreas tissues using anti-DNPEP antibody. Corresponding DNPEP RNA-seq data are presented for the same tissues.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Aspartyl Aminopeptidase Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SCFCALQALIDSCAGPGSLATEPHVRMVTLYDNEEVGSESAQGAQSLLTELVLRRISASCQHPTAFEEAIPKSFMISADMAHAVHPNYLD
Specificity
Specificity of human, mouse, rat Aspartyl Aminopeptidase antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DNPEP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000-1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Aspartyl Aminopeptidase Protein (NBP1-91684PEP)
Publications
Read Publication using NBP1-91684.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24743550)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Aspartyl Aminopeptidase Antibody

  • aspartyl aminopeptidase
  • ASPEPDAPEC 3.4.11.21

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2558
Species: Hu, Mu
Applications: WB, Simple Western
H00004068-M01
Species: Hu
Applications: WB, ELISA
NB100-1885
Species: Hu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
AF1180
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33855
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-89519
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89479
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-89953
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-92172
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP2-32887
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, PAGE, IF
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for Aspartyl Aminopeptidase Antibody (NBP1-91684)(1)

Reviews for Aspartyl Aminopeptidase Antibody (NBP1-91684) (0)

There are no reviews for Aspartyl Aminopeptidase Antibody (NBP1-91684). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Aspartyl Aminopeptidase Antibody (NBP1-91684) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Aspartyl Aminopeptidase Antibody (NBP1-91684)

Discover related pathways, diseases and genes to Aspartyl Aminopeptidase Antibody (NBP1-91684). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Aspartyl Aminopeptidase Antibody (NBP1-91684)

Discover more about diseases related to Aspartyl Aminopeptidase Antibody (NBP1-91684).
 

Pathways for Aspartyl Aminopeptidase Antibody (NBP1-91684)

View related products by pathway.

Research Areas for Aspartyl Aminopeptidase Antibody (NBP1-91684)

Find related products by research area.

Blogs on Aspartyl Aminopeptidase

There are no specific blogs for Aspartyl Aminopeptidase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Aspartyl Aminopeptidase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DNPEP