SF3A1 Antibody - BSA Free

Western Blot: SF3A1 Antibody [NBP1-87215] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented.

Immunocytochemistry/Immunofluorescence: SF3A1 Antibody [NBP1-87215] - Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear speckles.

Immunohistochemistry-Paraffin: SF3A1 Antibody [NBP1-87215] - Staining of human kidney.

Immunohistochemistry-Paraffin: SF3A1 Antibody [NBP1-87215] - Staining of human breast shows strong nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: SF3A1 Antibody [NBP1-87215] - Staining of human cerebral cortex, colon, kidney and testis using Anti-SF3A1 antibody NBP1-87215 (A) shows similar protein distribution across tissues to independent antibody NBP1-87214 (B).

Immunohistochemistry-Paraffin: SF3A1 Antibody [NBP1-87215] - Staining of human testis.

Immunohistochemistry-Paraffin: SF3A1 Antibody [NBP1-87215] - Staining of human colon.

Immunohistochemistry-Paraffin: SF3A1 Antibody [NBP1-87215] - Staining of human cerebral cortex.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, Mycoplasma
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SF3A1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SF3A1 Antibody - BSA Free (NBP1-87215) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: YPPPEVRNIVDKTASFVARNGPEFEARIRQNEINNPKFNFLNPNDPYHAYYRHKVSEFKEGKAQEPSAAIPKVMQQQQQTTQQQLPQKVQAQVIQETIVPKEPPPEFEFIADPPSISAFDLDVVKLTAQFVARNGRQFLTQLMQKEQRNYQFDFLRPQHSLFNYFTKLVEQYTKI
• Predicted Species: Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SF3A1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  SF3A1 Protein (NBP1-87215PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SF3A1 Antibody - BSA Free

• pre-mRNA processing 21
• pre-mRNA splicing factor SF3a (120 kDa subunit)
• Prp21
• PRPF21
• SAP 114
• SAP114splicing factor 3a, subunit 1, 120kD
• SF3a120
• spliceosome associated protein 114
• Spliceosome-associated protein 114
• splicing factor 3 subunit 1
• splicing factor 3A subunit 1
• splicing factor 3a, subunit 1, 120kDa

Background

SF3A1 encodes subunit 1 of the splicing factor 3a protein complex. The splicing factor 3a heterotrimer includes subunits 1, 2 and 3 and is necessary for the in vitro conversion of 15S U2 snRNP into an active 17S particle that performs pre-mRNA splicing. Subunit 1 belongs to the SURP protein family; named for the SURP (also called SWAP or Suppressor-of-White-APricot) motifs that are thought to mediate RNA binding. Subunit 1 has tandemly repeated SURP motifs in its amino-terminal half while its carboxy-terminal half contains a proline-rich region and a ubiquitin-like domain. Binding studies with truncated subunit 1 derivatives demonstrated that the two SURP motifs are necessary for binding to subunit 3 while contacts with subunit 2 may occur through sequences carboxy-terminal to the SURP motifs. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SF3A1