EEF1A2 Antibody - BSA Free

Western Blot: EEF1A2 Antibody [NBP2-33280] - Analysis in human cell line RPMI-8226.

Immunocytochemistry/Immunofluorescence: EEF1A2 Antibody [NBP2-33280] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green

Immunohistochemistry-Paraffin: EEF1A2 Antibody [NBP2-33280] - Staining of human skeletal muscle shows weak cytoplasmic positivity in a subset of myocytes.

Immunohistochemistry-Paraffin: EEF1A2 Antibody [NBP2-33280] - Staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: EEF1A2 Antibody [NBP2-33280] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: EEF1A2 Antibody [NBP2-33280] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

EEF1A2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit EEF1A2 Antibody - BSA Free (NBP2-33280) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-EEF1A2 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LLEALDTILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGIL
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EEF1A2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  EEF1A2 Protein (NBP2-33280PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for EEF1A2 Antibody - BSA Free

• eEF1A-2
• EEF1ALFLJ41696
• EF1A
• EF-1-alpha-2
• elongation factor 1-alpha 2
• elongation factor-1 alpha
• Eukaryotic elongation factor 1 A-2
• eukaryotic translation elongation factor 1 alpha 2
• HS1
• statin S1
• statin
• statin-like
• statin-S1
• STN
• STNL

Background

EEF1A2 encodes an isoform of the alpha subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This isoform (alpha 2) is expressed in brain, heart and skeletal muscle, and the other isoform (alpha 1) is expressed in brain, placenta, lung, liver, kidney, and pancreas. This gene may be critical in the development of ovarian cancer. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for EEF1A2 Antibody (NBP2-33280)(1)

Publication using NBP2-33280

• Qiu FN, Huang Y, Chen DY et al. Eukaryotic elongation factor-1alpha 2 knockdown inhibits hepatocarcinogenesis by suppressing PI3K/Akt/NF-kB signaling. World J. Gastroenterol. 2016-04-28 [PMID: 27122673] (IHC-P, WB, Human)

Bioinformatics

• Gene Symbol: EEF1A2
• Uniprot:
  • Q05639(Human)