EEF1A2 Antibody

Images

 
Western Blot: EEF1A2 Antibody [NBP2-33280] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: EEF1A2 Antibody [NBP2-33280] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green
Immunohistochemistry-Paraffin: EEF1A2 Antibody [NBP2-33280] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: EEF1A2 Antibody [NBP2-33280] - Staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: EEF1A2 Antibody [NBP2-33280] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: EEF1A2 Antibody [NBP2-33280] - Staining of human skeletal muscle shows weak cytoplasmic positivity in a subset of myocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EEF1A2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LLEALDTILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGIL
Specificity
Specificity of human EEF1A2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EEF1A2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
EEF1A2 Protein (NBP2-33280PEP)
Publications
Read Publication using
NBP2-33280 in the following applications:

  • 1 publication
  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for EEF1A2 Antibody

  • eEF1A-2
  • EEF1ALFLJ41696
  • EF1A
  • EF-1-alpha-2
  • elongation factor 1-alpha 2
  • elongation factor-1 alpha
  • Eukaryotic elongation factor 1 A-2
  • eukaryotic translation elongation factor 1 alpha 2
  • HS1
  • statin S1
  • statin
  • statin-like
  • statin-S1
  • STN
  • STNL

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-96417
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
H00023263-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NB110-68136
Species: Hu, Mu, Rt, Fe
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NBP2-75478
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-81858
Species: Hu
Applications: WB, IHC, IHC-P
H00003059-M02
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, PLA, RNAi, S-ELISA
NB300-223
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Eq
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-82257
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB300-574
Species: Hu, Mu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-25151
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, Dual ISH-IHC, IHC-FrFl, IHC-WhMt, KO
NBP1-59677
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87511
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90046
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-02554
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-534
Species: Hu, Mu, Po
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, RIA
NBP2-15895
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-23603
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-99205
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-33280
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for EEF1A2 Antibody (NBP2-33280)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: IHC-P, WB.


Filter By Application
IHC-P
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for EEF1A2 Antibody (NBP2-33280) (0)

There are no reviews for EEF1A2 Antibody (NBP2-33280). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for EEF1A2 Antibody (NBP2-33280) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional EEF1A2 Products

Bioinformatics Tool for EEF1A2 Antibody (NBP2-33280)

Discover related pathways, diseases and genes to EEF1A2 Antibody (NBP2-33280). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EEF1A2 Antibody (NBP2-33280)

Discover more about diseases related to EEF1A2 Antibody (NBP2-33280).
 

Pathways for EEF1A2 Antibody (NBP2-33280)

View related products by pathway.

PTMs for EEF1A2 Antibody (NBP2-33280)

Learn more about PTMs related to EEF1A2 Antibody (NBP2-33280).

Blogs on EEF1A2

There are no specific blogs for EEF1A2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EEF1A2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EEF1A2
Uniprot