Reactivity | Hu, Mu, RtSpecies Glossary |
Applications | WB, ICC/IF, IHC, IHC-P |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LLEALDTILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGIL |
Specificity | Specificity of human EEF1A2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Predicted Species | Mouse (100%), Rat (100%). Backed by our 100% Guarantee. |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | EEF1A2 |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
Control Peptide |
|
||
Publications |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Immunogen affinity purified |
Publication using NBP2-33280 | Applications | Species |
---|---|---|
Qiu FN, Huang Y, Chen DY et al. Eukaryotic elongation factor-1alpha 2 knockdown inhibits hepatocarcinogenesis by suppressing PI3K/Akt/NF-kB signaling. World J. Gastroenterol. 2016 Apr 28 [PMID: 27122673] (WB, IHC-P, Human) | WB, IHC-P | Human |
Secondary Antibodies |
Isotype Controls |
Diseases for EEF1A2 Antibody (NBP2-33280)Discover more about diseases related to EEF1A2 Antibody (NBP2-33280).
| Pathways for EEF1A2 Antibody (NBP2-33280)View related products by pathway.
|
PTMs for EEF1A2 Antibody (NBP2-33280)Learn more about PTMs related to EEF1A2 Antibody (NBP2-33280).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.