SF3A2 Antibody

Images

 
Independent Antibodies: Western Blot: SF3A2 Antibody [NBP2-47281] - Analysis using Anti-SF3A2 antibody NBP2-47281 (A) shows similar pattern to independent antibody NBP2-48775 (B).
Immunocytochemistry/ Immunofluorescence: SF3A2 Antibody [NBP2-47281] - Immunofluorescent staining of human cell line HEK 293 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: SF3A2 Antibody [NBP2-47281] - Staining of human kidney.
Genetic Strategies: Western Blot: SF3A2 Antibody [NBP2-47281] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented.
Immunohistochemistry: SF3A2 Antibody [NBP2-47281] - Staining of human pancreas shows strong nuclear positivity in exocrine glandular cells.
Independent Antibodies: Immunohistochemistry-Paraffin: SF3A2 Antibody [NBP2-47281] - Staining of human cerebral cortex, colon, kidney and testis using Anti-SF3A2 antibody NBP2-47281 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: SF3A2 Antibody [NBP2-47281] - Staining of human testis.
Immunohistochemistry-Paraffin: SF3A2 Antibody [NBP2-47281] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: SF3A2 Antibody [NBP2-47281] - Staining of human colon.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SF3A2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: SSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCLTLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAPAQPAPEKVKVE
Specificity
Specificity of human SF3A2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SF3A2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SF3A2 Protein (NBP2-47281PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SF3A2 Antibody

  • pre-mRNA splicing factor SF3A, subunit 2
  • PRP11
  • PRPF11
  • SAP 62
  • SAP62Prp11
  • SF3a66splicing factor 3a, subunit 2, 66kD
  • spliceosome associated protein 62
  • Spliceosome-associated protein 62
  • splicing factor 3A subunit 2
  • splicing factor 3a, subunit 2, 66kDa

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87212
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-79843
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, ChIP
NBP2-52501
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-58327
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-67569
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP3-03306
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-92873
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00007001-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, KD
NBP1-88262
Species: Hu
Applications: WB, IHC, IHC-P
H00010691-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP2-13920
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-79848
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-83565
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, KD
NBP1-83217
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00085320-M02
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, S-ELISA
NBP1-74190
Species: Mu
Applications: WB, ChIP
NBP1-52823
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SF3A2 Antibody (NBP2-47281) (0)

There are no publications for SF3A2 Antibody (NBP2-47281).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SF3A2 Antibody (NBP2-47281) (0)

There are no reviews for SF3A2 Antibody (NBP2-47281). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SF3A2 Antibody (NBP2-47281) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SF3A2 Products

Array NBP2-47281

Bioinformatics Tool for SF3A2 Antibody (NBP2-47281)

Discover related pathways, diseases and genes to SF3A2 Antibody (NBP2-47281). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SF3A2 Antibody (NBP2-47281)

Discover more about diseases related to SF3A2 Antibody (NBP2-47281).
 

Pathways for SF3A2 Antibody (NBP2-47281)

View related products by pathway.

Blogs on SF3A2

There are no specific blogs for SF3A2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SF3A2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SF3A2