DDX46 Antibody - BSA Free

Staining of human cerebral cortex shows strong nuclear positivity in neurons.

Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.

Staining of human colon shows strong nuclear positivity in glandular cells.

Staining of human skeletal muscle shows strong nuclear positivity in myocytes.

Analysis in HEK293 cells) transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-DDX46 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC, Mycoplasma
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DDX46 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit DDX46 Antibody - BSA Free (NBP1-83565) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KEGNEMEGEELDPLDAYMEEVKEEVKKFNMRSVKGGGGNEKKSGPTVTKVVTVVTTKKAVVDSDKKKGELMENDQDAM
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DDX46
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  DDX46 Protein (NBP1-83565PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for DDX46 Antibody - BSA Free

• DEAD (Asp-Glu-Ala-Asp) box polypeptide 46
• DEAD box protein 46
• EC 3.6.1
• EC 3.6.4.13
• FLJ25329
• KIAA0801probable ATP-dependent RNA helicase DDX46
• MGC9936
• PRP5 homolog
• Prp5
• Prp5-like DEAD-box protein
• PRPF5
• RNA helicase

Background

DDX46 encodes a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The protein encoded by this gene is a component of the 17S U2 snRNP complex; it plays an important role in pre-mRNA splicing.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DDX46