DDX46 Antibody


Western Blot: DDX46 Antibody [NBP1-83565] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: DDX46 Antibody [NBP1-83565] - Staining of human testis shows strong nuclear positivity in seminiferous tubules.
Western Blot: DDX46 Antibody [NBP1-83565] - Analysis in human cell line HEK 293.
Genetic Strategies: Western Blot: DDX46 Antibody [NBP1-83565] - Analysis in HEK293 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-DDX46 antibody. Remaining relative ...read more

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P, KD
Validated by:

Genetic Strategies


Order Details

DDX46 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: KEGNEMEGEELDPLDAYMEEVKEEVKKFNMRSVKGGGGNEKKSGPTVTKVVTVVTTKKAVVDSDKKKGELMENDQDAM
Specificity of human, mouse, rat DDX46 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DDX46 Protein (NBP1-83565PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for DDX46 Antibody

  • DEAD (Asp-Glu-Ala-Asp) box polypeptide 46
  • DEAD box protein 46
  • EC 3.6.1
  • EC
  • FLJ25329
  • KIAA0801probable ATP-dependent RNA helicase DDX46
  • MGC9936
  • PRP5 homolog
  • Prp5
  • Prp5-like DEAD-box protein
  • PRPF5
  • RNA helicase


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, ChIP
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Fi, Ha, Pm, Sh
Applications: WB, Simple Western, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, KD

Publications for DDX46 Antibody (NBP1-83565) (0)

There are no publications for DDX46 Antibody (NBP1-83565).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DDX46 Antibody (NBP1-83565) (0)

There are no reviews for DDX46 Antibody (NBP1-83565). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DDX46 Antibody (NBP1-83565) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for DDX46 Antibody (NBP1-83565)

Discover related pathways, diseases and genes to DDX46 Antibody (NBP1-83565). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DDX46 Antibody (NBP1-83565)

Discover more about diseases related to DDX46 Antibody (NBP1-83565).

Pathways for DDX46 Antibody (NBP1-83565)

View related products by pathway.

PTMs for DDX46 Antibody (NBP1-83565)

Learn more about PTMs related to DDX46 Antibody (NBP1-83565).

Blogs on DDX46

There are no specific blogs for DDX46, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our DDX46 Antibody and receive a gift card or discount.


Gene Symbol DDX46