Intersectin 2 Antibody - Azide and BSA Free Summary
| Description |
Novus Biologicals Rabbit Intersectin 2 Antibody - Azide and BSA Free (NBP3-03747) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 500-620 of human Intersectin 2 (NP_006268.2). GKHQQISGRLQDVRLKKQTQKTELEVLDKQCDLEIMEIKQLQQELQEYQNKLIYLVPEKQLLNERIKNMQFSNTPDSGVSLLHKKSLEKEELCQRLKEQLDALEKETASKLSEMDSFNNQL |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ITSN2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 1:50-1:200
- Western Blot 1:500-1:2000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.01% Thimerosal |
| Purity |
Affinity purified |
Alternate Names for Intersectin 2 Antibody - Azide and BSA Free
Background
Intersectin-2 is a cytoplasmic adapter protein that may provide a link between the actin assembly machinery and the endocytic membrance traffic, as well a control the production of clathrin-coated vesicles in terms of their invagination of budding. Intersectin-2 has four isoforms, with lengths of 1697, 1670, 1249, and 1192 amino acids and weights of 193, 190, 141, and 135 kDa respectively. Studies have been conducted on diseases and disorders related to this protein including Wiskott-Aldrich syndrome, dermatitis, sarcoma, schizophrenia, spasticity, pancreatitis, and pancreatic cancer. Intersectin-2 has also been known to have interactions with BCCIP, PTN, TBL3, MAP4K3, and SEMA6A in pathways such as the regulation of CDC42 activity pathway.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: ELISA
Species: Hu, Mu
Applications: ELISA, Flow, Func, WB
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Mu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: Neut, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: WB
Species: Hu, Pm, Mu
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: CHIP-SEQ, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov
Publications for Intersectin 2 Antibody (NBP3-03747) (0)
There are no publications for Intersectin 2 Antibody (NBP3-03747).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Intersectin 2 Antibody (NBP3-03747) (0)
There are no reviews for Intersectin 2 Antibody (NBP3-03747).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Intersectin 2 Antibody (NBP3-03747) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Intersectin 2 Products
Research Areas for Intersectin 2 Antibody (NBP3-03747)
Find related products by research area.
|
Blogs on Intersectin 2