SETDB1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SETDB1 Antibody [NBP2-56678] - Staining of human cell line U-251 MG shows localization to nucleoplasm.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SETDB1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SGTSRKPTAGQTSATAVDSDDIQTISSGSEGDDFEDKKNMTGPMKRQVAVKSTRGFALKSTHGIAIKSTNMASVDKGESAPVRKNTRQFYDGEESCY
Specificity
Specificity of human SETDB1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SETDB1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for SETDB1 Antibody

  • ERG-associated protein with SET domain
  • ESETEC 2.1.1.43
  • H3-K9-HMTase 4
  • Histone H3-K9 methyltransferase 4
  • histone-lysine N-methyltransferase SETDB1
  • histone-lysine N-methyltransferase, H3lysine-9 specific 4
  • KG1T
  • KIAA0067H3-K9-HMTase4
  • KMT1EERG-associated protein with a SET domain, ESET
  • Lysine N-methyltransferase 1E
  • SET domain bifurcated 1
  • SET domain, bifurcated 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-30141
Species: Hu, Mu, Rt, Po, Ce, Dr, In, Ma, Ye
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-2350
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-13948
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-52420
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-27562
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-17086
Species: Hu, Mu, Mk
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-01245
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-22106
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NB100-56326
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84610
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB100-56519
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC, IHC-FrFl
H00051701-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, PLA
NBP2-67375
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
PP-B0422-00
Species: Hu, Mu
Applications: WB, IHC, IP, DirELISA
NB100-2379
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, Flow, ICC/IF, IHC
NB100-381
Species: Hu
Applications: WB, ChIP, IP
NBP2-24583
Species: Hu, Mu, Rt, Bv, Eq, Op, Pm
Applications: WB, IHC-P
NB120-13888
Species: Hu, Mu
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, IHC-WhMt

Publications for SETDB1 Antibody (NBP2-56678) (0)

There are no publications for SETDB1 Antibody (NBP2-56678).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SETDB1 Antibody (NBP2-56678) (0)

There are no reviews for SETDB1 Antibody (NBP2-56678). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SETDB1 Antibody (NBP2-56678) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SETDB1 Products

Bioinformatics Tool for SETDB1 Antibody (NBP2-56678)

Discover related pathways, diseases and genes to SETDB1 Antibody (NBP2-56678). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SETDB1 Antibody (NBP2-56678)

Discover more about diseases related to SETDB1 Antibody (NBP2-56678).
 

Pathways for SETDB1 Antibody (NBP2-56678)

View related products by pathway.

PTMs for SETDB1 Antibody (NBP2-56678)

Learn more about PTMs related to SETDB1 Antibody (NBP2-56678).
 

Research Areas for SETDB1 Antibody (NBP2-56678)

Find related products by research area.

Blogs on SETDB1

There are no specific blogs for SETDB1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SETDB1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SETDB1