SELENBP1 Antibody - BSA Free

Western Blot: SELENBP1 Antibody [NBP1-83197] - Analysis in human cell line SK-BR-3.

Immunohistochemistry-Paraffin: SELENBP1 Antibody [NBP1-83197] - Staining of human liver shows strong cytoplasmic and nuclear positivity in hepatocytes.

Western Blot: SELENBP1 Antibody [NBP1-83197] - Analysis in control (vector only transfected HEK293T lysate) and SELENBP1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: SELENBP1 Antibody [NBP1-83197] - Staining of human liver shows high expression.

Immunohistochemistry-Paraffin: SELENBP1 Antibody [NBP1-83197] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry-Paraffin: SELENBP1 Antibody [NBP1-83197] - Staining in human liver and pancreas tissues using anti-SELENBP1 antibody. Corresponding SELENBP1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: SELENBP1 Antibody [NBP1-83197] - Staining of human fallopian tube.

Immunohistochemistry-Paraffin: SELENBP1 Antibody [NBP1-83197] - Staining of human colon.

Immunohistochemistry-Paraffin: SELENBP1 Antibody [NBP1-83197] - Analysis in human colon and tonsil tissues. Corresponding SELENBP1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: SELENBP1 Antibody [NBP1-83197] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: SELENBP1 Antibody [NBP1-83197] - Staining of human colon, fallopian tube, liver and tonsil using Anti-SELENBP1 antibody NBP1-83197 (A) shows similar protein distribution across tissues to independent antibody NBP1-83196 (B).

Immunohistochemistry: SELENBP1 Antibody [NBP1-83197] - Staining of human Fallopian tube shows weak to moderate nuclear positivity in glandular cells.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SELENBP1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SELENBP1 Antibody - BSA Free (NBP1-83197) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: IEPKDIHAKCELAFLHTSHCLASGEVMISSLGDVKGNGKGGFVLLDGETFEVKGTWERPGGAAPLGYDFWYQPRHNVMISTEWAAPNVLRDGFNPADV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SELENBP1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 1:100-1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  SELENBP1 Protein (NBP1-83197PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%), Rat (85%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SELENBP1 Antibody - BSA Free

• 56 kDa selenium-binding protein
• hSBP
• hSP56
• LPSB
• SBP
• SBP56
• selenium binding protein 1
• selenium-binding protein 1
• SP56FLJ13813

Background

The SELENBP1 gene product belongs to the selenium-binding protein family. Selenium is an essential nutrient that exhibits potent anticarcinogenic properties, and deficiency of selenium may cause certain neurologic diseases. It has been proposed that the effects o

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SELENBP1