SELENBP1 Antibody - BSA Free

Western Blot: SELENBP1 Antibody [NBP1-55263] - Sample Type: Human Adult Placenta Antibody Dilution: 1.0 ug/ml

Immunohistochemistry: SELENBP1 Antibody [NBP1-55263] - Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue Observed Staining: Cytoplasmic, membrane and nuclear in alveolar type I & II cells Primary Antibody Concentration: 1:100 Other Working Concentrations: 1/600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec

Western Blot: SELENBP1 Antibody [NBP1-55263] - Sample Type: Human Fetal Liver Antibody Dilution: 1.0 ug/ml

Western Blot: SELENBP1 Antibody [NBP1-55263] - Sample Type: MCF7 Antibody Dilution: 1.0 ug/ml SELENBP1 is supported by BioGPS gene expression data to be expressed in MCF7

Western Blot: SELENBP1 Antibody [NBP1-55263] - Sample Tissue: Human 721_B Antibody Dilution: 1.0 ug/ml

Western Blot: SELENBP1 Antibody [NBP1-55263] - Reccomended Titration: 0.2 - 1 ug/ml Positive Control: 721_B cell lysate

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

SELENBP1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to SELENBP1(selenium binding protein 1) The peptide sequence was selected from the C terminal of SELENBP1 (AAH32997). Peptide sequence KQFYPDLIREGSVMLQVDVDTVKGGLKLNPNFLVDFGKEPLGPALAHELR. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SELENBP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml
• Theoretical MW: 44 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for SELENBP1 Antibody - BSA Free

• 56 kDa selenium-binding protein
• hSBP
• hSP56
• LPSB
• SBP
• SBP56
• selenium binding protein 1
• selenium-binding protein 1
• SP56FLJ13813

Background

SELENBP1 belongs to the selenium-binding protein family. Selenium is an essential nutrient that exhibits potent anticarcinogenic properties, and deficiency of selenium may cause certain neurologic diseases. It has been proposed that the effects of selenium in preventing cancer and neurologic diseases may be mediated by selenium-binding proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SELENBP1
• Entrez:
  • 8991(Human)
• Uniprot:
  • Q13228(Human)