SELENBP1 Antibody


Western Blot: SELENBP1 Antibody [NBP1-55263] - Sample Type: Human Adult Placenta Antibody Dilution: 1.0 ug/ml
Immunohistochemistry: SELENBP1 Antibody [NBP1-55263] - Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue Observed Staining: Cytoplasmic, membrane and nuclear in alveolar type I & II cells Primary Antibody more
Western Blot: SELENBP1 Antibody [NBP1-55263] - Sample Type: Human Fetal Liver Antibody Dilution: 1.0 ug/ml
Western Blot: SELENBP1 Antibody [NBP1-55263] - Sample Type: MCF7 Antibody Dilution: 1.0 ug/ml SELENBP1 is supported by BioGPS gene expression data to be expressed in MCF7
Western Blot: SELENBP1 Antibody [NBP1-55263] - Sample Tissue: Human 721_B Antibody Dilution: 1.0 ug/ml
Western Blot: SELENBP1 Antibody [NBP1-55263] - Reccomended Titration: 0.2 - 1 ug/ml Positive Control: 721_B cell lysate

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC

Order Details

SELENBP1 Antibody Summary

Synthetic peptides corresponding to SELENBP1(selenium binding protein 1) The peptide sequence was selected from the C terminal of SELENBP1 (AAH32997). Peptide sequence KQFYPDLIREGSVMLQVDVDTVKGGLKLNPNFLVDFGKEPLGPALAHELR.
Recognizes C-terminal region on both isoforms of SELENBP1.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2-1 ug/ml
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
Theoretical MW
44 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Positive Control
SELENBP1 Lysate (NBP2-65117)

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SELENBP1 Antibody

  • 56 kDa selenium-binding protein
  • hSBP
  • hSP56
  • LPSB
  • SBP
  • SBP56
  • selenium binding protein 1
  • selenium-binding protein 1
  • SP56FLJ13813


SELENBP1 belongs to the selenium-binding protein family. Selenium is an essential nutrient that exhibits potent anticarcinogenic properties, and deficiency of selenium may cause certain neurologic diseases. It has been proposed that the effects of selenium in preventing cancer and neurologic diseases may be mediated by selenium-binding proteins.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF, ICC
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD

Publications for SELENBP1 Antibody (NBP1-55263) (0)

There are no publications for SELENBP1 Antibody (NBP1-55263).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SELENBP1 Antibody (NBP1-55263) (0)

There are no reviews for SELENBP1 Antibody (NBP1-55263). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SELENBP1 Antibody (NBP1-55263) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for SELENBP1 Antibody (NBP1-55263)

Discover related pathways, diseases and genes to SELENBP1 Antibody (NBP1-55263). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SELENBP1 Antibody (NBP1-55263)

Discover more about diseases related to SELENBP1 Antibody (NBP1-55263).

Pathways for SELENBP1 Antibody (NBP1-55263)

View related products by pathway.

PTMs for SELENBP1 Antibody (NBP1-55263)

Learn more about PTMs related to SELENBP1 Antibody (NBP1-55263).

Blogs on SELENBP1

There are no specific blogs for SELENBP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SELENBP1 Antibody and receive a gift card or discount.


Gene Symbol SELENBP1