Secretagogin Antibody (9K8H9)

Immunohistochemistry-Paraffin: Secretagogin Antibody (9K8H9) [NBP3-15814] - Immunohistochemistry of paraffin-embedded mouse stomach using Secretagogin (Secretagogin) Rabbit mAb (NBP3-15814) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: Secretagogin Antibody (9K8H9) [NBP3-15814] - Immunohistochemistry of paraffin-embedded rat pancreatic islet using Secretagogin (Secretagogin) Rabbit mAb (NBP3-15814) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: Secretagogin Antibody (9K8H9) [NBP3-15814] - Immunohistochemistry of paraffin-embedded human colon using Secretagogin (Secretagogin) Rabbit mAb (NBP3-15814) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Western Blot: Secretagogin Antibody (9K8H9) [Secretagogin] - Western blot analysis of various lysates using Secretagogin (Secretagogin) Rabbit mAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 180s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clone: 9K8H9
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Secretagogin Antibody (9K8H9) Summary

• Description: Novus Biologicals Rabbit Secretagogin Antibody (9K8H9) (NBP3-15814) is a recombinant monoclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 177-276 of human Secretagogin (Secretagogin) (O76038). ILALQENFLLQFKMDACSTEERKRDFEKIFAYYDVSKTGALEGPEVDGFVKDMMELVQPSISGVDLDKFREILLRHCDVNKDGKIQKSELALCLGLKINP
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: SCGN
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Secretagogin Antibody (9K8H9)

• CALBL
• DJ501N12.8
• SCGN
• SECRET
• Secretagogin
• secretagogin, EF-hand calcium binding protein
• SECRETsecretagogin
• SEGN
• Setagin

Background

The encoded protein is a secreted calcium-binding protein which is found in the cytoplasm. It is related to calbindin D-28K and calretinin. This protein is thought to be involved in KCL-stimulated calcium flux and cell proliferation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SCGN