SCYL1BP1 Antibody - BSA Free

Western Blot: SCYL1BP1 Antibody [NBP3-35737] - Western blot analysis of various lysates using SCYL1BP1 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 1s.

• Reactivity: Hu, Mu
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SCYL1BP1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SCYL1BP1 Antibody - BSA Free (NBP3-35737) is a polyclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SCYL1BP1 (NP_001139511.1).
  
  Sequence:
  MSWAAVLAVAAARFGHFWGCRWPGPMAQGWAGFSEEELRRLKQTKDPFEPQRRLPAKKSRQQLQREKALVEQSQKLGLQDGSTSLLPEQLLSAPKQRVNV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GORAB
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 42 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for SCYL1BP1 Antibody - BSA Free

• FLJ11752
• golgin, RAB6-interacting
• GONTKL-binding protein 1
• hNTKL-BP1
• MGC51263
• MGC70512
• N-terminal kinase-like-binding protein 1
• NTKL-BP1
• NTKLBP1SCY1-like 1-binding protein 1
• RAB6-interacting golgin
• SCY1-like 1 binding protein 1
• SCYL1-BP1
• SCYL1BP1SCYL1-binding protein 1

Background

NTKL-binding protein 1 (GORAB) belongs to the golgin family of coiled-coil proteins located in the golgi apparatus. GORAB interacts with SCYL1, RCHY1 and RAB6A/RAB6. At least 4 isoforms are produced by alternative splicing.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GORAB