Pirh2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Pirh2 Antibody [NBP1-90098] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: Pirh2 Antibody [NBP1-90098] - Staining of human stomach shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Pirh2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:CDICHLFDKDKKQYHCENCGICRIGPKEDFFHCLKCNLCLAMNLQGRHKCIENVSRQNCPICLEDIHTSRVVAHVLPCGHL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RCHY1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Pirh2 Protein (NBP1-90098PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Pirh2 Antibody

  • Androgen receptor N-terminal-interacting protein
  • androgen-receptor N-terminal-interacting protein
  • ARNIPRING finger protein 199
  • CHIMPRNF199DKFZp586C1620
  • CH-rich interacting match with PLAG1
  • CH-rich-interacting match with PLAG1
  • E3 ubiquitin-protein ligase Pirh2
  • EC 6.3.2.-
  • hARNIP
  • hPirh2
  • PIRH2
  • PRO1996
  • ring finger and CHY zinc finger domain containing 1
  • RING finger and CHY zinc finger domain-containing protein 1
  • Zinc finger protein 363p53-induced RING-H2 protein
  • ZNF363

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-2736
Species: Hu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00064326-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59068
Species: Hu
Applications: WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
AF1555
Species: Hu
Applications: WB
H00114769-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-45912
Species: Hu
Applications: WB, IHC
MAB6609
Species: Hu, Mu
Applications: WB, IHC
NB100-1591
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP2-24613
Species: Hu
Applications: WB, Simple Western, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP1-84745
Species: Hu
Applications: IHC, IHC-P
NBP1-90098
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for Pirh2 Antibody (NBP1-90098) (0)

There are no publications for Pirh2 Antibody (NBP1-90098).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Pirh2 Antibody (NBP1-90098) (0)

There are no reviews for Pirh2 Antibody (NBP1-90098). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Pirh2 Antibody (NBP1-90098) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Pirh2 Products

Bioinformatics Tool for Pirh2 Antibody (NBP1-90098)

Discover related pathways, diseases and genes to Pirh2 Antibody (NBP1-90098). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Pirh2 Antibody (NBP1-90098)

Discover more about diseases related to Pirh2 Antibody (NBP1-90098).
 

Pathways for Pirh2 Antibody (NBP1-90098)

View related products by pathway.

PTMs for Pirh2 Antibody (NBP1-90098)

Learn more about PTMs related to Pirh2 Antibody (NBP1-90098).
 

Research Areas for Pirh2 Antibody (NBP1-90098)

Find related products by research area.

Blogs on Pirh2

There are no specific blogs for Pirh2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Pirh2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RCHY1