CSE1L/CAS/Exportin-2 Antibody (3D8)

Images

 
Western Blot: CSE1L/CAS/Exportin-2 Antibody (3D8) [H00001434-M08] - Analysis of CSE1L expression in Hela S3 NE (Cat # L013V3).
Immunocytochemistry/ Immunofluorescence: CSE1L/CAS/Exportin-2 Antibody (3D8) [H00001434-M08] - Analysis of monoclonal antibody to CSE1L on HeLa cell. Antibody concentration 10 ug/ml
Immunohistochemistry-Paraffin: CSE1L/CAS/Exportin-2 Antibody (3D8) [H00001434-M08] - Analysis of monoclonal antibody to CSE1L on formalin-fixed paraffin-embedded human prostate. Antibody concentration 3 ug/ml
ELISA: CSE1L/CAS/Exportin-2 Antibody (3D8) [H00001434-M08] - Detection limit for recombinant GST tagged CSE1L is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
Clone
3D8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CSE1L/CAS/Exportin-2 Antibody (3D8) Summary

Immunogen
CSE1L (NP_001307, 872 a.a. ~ 971 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LIGLFELPEDDTIPDEEHFIDIEDTPGYQTAFSQLAFAGKKEHDPVGQMVNNPKIHLAQSLHKLSTACPGRVPSMVSTSLNAEALQYLQGYLQAARVTLL
Specificity
CSE1L - CSE1 chromosome segregation 1-like (yeast)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CSE1L
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB.
Publications
Read Publications using H00001434-M08.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CSE1L/CAS/Exportin-2 Antibody (3D8)

  • CAS
  • CASMGC117283
  • Cellular apoptosis susceptibility protein
  • chromosome segregation 1 (yeast homolog)-like
  • Chromosome segregation 1-like protein
  • CSE1 chromosome segregation 1-like (yeast)
  • CSE1
  • CSE1L
  • exp2
  • exportin-2
  • Importin-alpha re-exporter
  • MGC130037
  • XPO2
  • XPO2MGC130036

Background

Proteins that carry a nuclear localization signal (NLS) are transported into the nucleus by the importin-alpha/beta heterodimer. Importin-alpha binds the NLS, while importin-beta mediates translocation through the nuclear pore complex. After translocation, RanGTP binds importin-beta and displaces importin-alpha. Importin-alpha must then be returned to the cytoplasm, leaving the NLS protein behind. The protein encoded by this gene binds strongly to NLS-free importin-alpha, and this binding is released in the cytoplasm by the combined action of RANBP1 and RANGAP1. In addition, the encoded protein may play a role both in apoptosis and in cell proliferation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34594
Species: Hu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
AF4478
Species: Hu
Applications: WB, IHC
NBP2-67327
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-00532
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-82455
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-58200
Species: Hu, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38206
Species: Hu
Applications: WB, IHC, IHC-P, KD
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-24459
Species: Hu, Mu, Rt, Ca, Ch, Pm, Rb, RM, Xp, Ze
Applications: WB, ICC/IF
NBP2-67627
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-1699
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ch, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-1519
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, PEP-ELISA, IHC-FrFl

Publications for CSE1L/CAS/Exportin-2 Antibody (H00001434-M08)(13)


Showing Publications 1 - 10 of 13. Show All 13 Publications.
Publications using H00001434-M08 Applications Species
Stella Tsai CS, Chen HC, Tung JN et al. Serum cellular apoptosis susceptibility protein is a potential prognostic marker for metastatic colorectal cancer. Am J Pathol. 2010 Apr176(4):1619-28. [PMID: 20150437]
Wu PR, Yeh CM, Chang CC et al. Oncogenic Ras expression increases cytoplasmic distribution and phosphorylation of CSE1L in B16F10 melanoma cells. Int J Clin Exp Pathol 2016 Oct 15
Lee WR, Shen SC, Wu PR et al. CSE1L Links cAMP/PKA and Ras/ERK pathways and regulates the expressions and phosphorylations of ERK1/2, CREB, and MITF in melanoma cells. Mol Carcinog. 2015 Sep 01 [PMID: 26331446]
Okimoto S, Sun J, Fukuto A et al. hCAS/CSE1L regulates RAD51 distribution and focus formation for homologous recombinational repair. Genes Cells. 2015 Jun 30 [PMID: 26123175]
Lee WR, Shen SC, Shih YH5 et al. Early decline in serum phospho-CSE1L levels in vemurafenib/sunitinib-treated melanoma and sorafenib/lapatinib-treated colorectal tumor xenografts. J Transl Med. 2015 Jun 13 [PMID: 26070816]
Chin SY, Wu PR, Shih YH et al. High expression of cytoplasmic phosphorylated CSE1L in malignant melanoma but not in benign nevi: phosphorylated CSE1L for the discrimination between melanoma and benign nevi. Int J Clin Exp Pathol. 2015 [PMID: 25973023]
Jiang MC, Yeh CM, Tai CJ et al. CSE1L modulates Ras-induced cancer cell invasion: correlation of K-Ras mutation and CSE1L expression in colorectal cancer progression. Am J Surg. 2013 Jun 24 [PMID: 23806821]
Li KK, Yang L, Pang JC et al. MIR-137 Suppresses Growth and Invasion, is Downregulated in Oligodendroglial Tumors and Targets CSE1L. Brain Pathol. 2012 Dec 10 [PMID: 23252729]
Chang CC, Tai CJ, Su TC et al. The prognostic significance of nuclear CSE1L in urinary bladder urothelial carcinomas. Ann Diagn Pathol. 2012 Apr 02 [PMID: 22476051]
Uen WC, Tai CJ, Shen SC et al. Differential distributions of CSE1L/CAS and E-cadherin in the polarized and non-polarized epithelial glands of neoplastic colorectal epithelium. J Mol Histol. 2010 Aug 24 [PMID: 20734115]
Show All 13 Publications.

Reviews for CSE1L/CAS/Exportin-2 Antibody (H00001434-M08) (0)

There are no reviews for CSE1L/CAS/Exportin-2 Antibody (H00001434-M08). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CSE1L/CAS/Exportin-2 Antibody (H00001434-M08) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CSE1L/CAS/Exportin-2 Products

Bioinformatics Tool for CSE1L/CAS/Exportin-2 Antibody (H00001434-M08)

Discover related pathways, diseases and genes to CSE1L/CAS/Exportin-2 Antibody (H00001434-M08). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CSE1L/CAS/Exportin-2 Antibody (H00001434-M08)

Discover more about diseases related to CSE1L/CAS/Exportin-2 Antibody (H00001434-M08).
 

Pathways for CSE1L/CAS/Exportin-2 Antibody (H00001434-M08)

View related products by pathway.

PTMs for CSE1L/CAS/Exportin-2 Antibody (H00001434-M08)

Learn more about PTMs related to CSE1L/CAS/Exportin-2 Antibody (H00001434-M08).
 

Research Areas for CSE1L/CAS/Exportin-2 Antibody (H00001434-M08)

Find related products by research area.

Blogs on CSE1L/CAS/Exportin-2

There are no specific blogs for CSE1L/CAS/Exportin-2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CSE1L/CAS/Exportin-2 Antibody (3D8) and receive a gift card or discount.

Bioinformatics

Gene Symbol CSE1L
Entrez
OMIM
Uniprot