CSE1L/CAS/Exportin-2 Antibody (3D8)

Western Blot: CSE1L/CAS/Exportin-2 Antibody (3D8) [H00001434-M08] - Analysis of CSE1L expression in Hela S3 NE (Cat # L013V3).

Immunocytochemistry/Immunofluorescence: CSE1L/CAS/Exportin-2 Antibody (3D8) [H00001434-M08] - Analysis of monoclonal antibody to CSE1L on HeLa cell. Antibody concentration 10 ug/mL.

Immunohistochemistry-Paraffin: CSE1L/CAS/Exportin-2 Antibody (3D8) [H00001434-M08] - Mouse prostate tissue section stained with primary antibody for 10 hrs. IHC-P image submitted by a verified customer review.

Immunohistochemistry-Paraffin: CSE1L/CAS/Exportin-2 Antibody (3D8) [H00001434-M08] - Analysis of monoclonal antibody to CSE1L on FFPE human prostate. Antibody concentration 3 ug/mL.

ELISA: CSE1L/CAS/Exportin-2 Antibody (3D8) [H00001434-M08] - Detection limit for recombinant GST tagged CSE1L is approximately 3ng/ml as a capture antibody.

• Reactivity: Hu, Mu
• Applications: WB, ELISA, ICC/IF, IHC, IHC-P
• Clone: 3D8
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated

CSE1L/CAS/Exportin-2 Antibody (3D8) Summary

• Immunogen: CSE1L (NP_001307, 872 a.a. ~ 971 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LIGLFELPEDDTIPDEEHFIDIEDTPGYQTAFSQLAFAGKKEHDPVGQMVNNPKIHLAQSLHKLSTACPGRVPSMVSTSLNAEALQYLQGYLQAARVTLL
• Specificity: CSE1L - CSE1 chromosome segregation 1-like (yeast)
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: CSE1L
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
• Application Notes: Antibody reactivity against cell lysate and recombinant protein for WB.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CSE1L/CAS/Exportin-2 Antibody (3D8)

• CAS
• CASMGC117283
• Cellular apoptosis susceptibility protein
• chromosome segregation 1 (yeast homolog)-like
• Chromosome segregation 1-like protein
• CSE1 chromosome segregation 1-like (yeast)
• CSE1
• CSE1L
• exp2
• exportin-2
• Importin-alpha re-exporter
• MGC130037
• XPO2
• XPO2MGC130036

Background

Proteins that carry a nuclear localization signal (NLS) are transported into the nucleus by the importin-alpha/beta heterodimer. Importin-alpha binds the NLS, while importin-beta mediates translocation through the nuclear pore complex. After translocation, RanGTP binds importin-beta and displaces importin-alpha. Importin-alpha must then be returned to the cytoplasm, leaving the NLS protein behind. The protein encoded by this gene binds strongly to NLS-free importin-alpha, and this binding is released in the cytoplasm by the combined action of RANBP1 and RANGAP1. In addition, the encoded protein may play a role both in apoptosis and in cell proliferation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CSE1L/CAS/Exportin-2 Antibody (H00001434-M08)(11)

Publications using H00001434-M08

• Lee WR, Shen SC, Wu PR et al. CSE1L Links cAMP/PKA and Ras/ERK pathways and regulates the expressions and phosphorylations of ERK1/2, CREB, and MITF in melanoma cells. Mol Carcinog 2015-09-01 [PMID: 26331446]
• Okimoto S, Sun J, Fukuto A et al. hCAS/CSE1L regulates RAD51 distribution and focus formation for homologous recombinational repair. Genes Cells. 2015-06-30 [PMID: 26123175]
• Lee WR, Shen SC, Shih YH5 et al. Early decline in serum phospho-CSE1L levels in vemurafenib/sunitinib-treated melanoma and sorafenib/lapatinib-treated colorectal tumor xenografts. J Transl Med. 2015-06-13 [PMID: 26070816]
• Chin SY, Wu PR, Shih YH et al. High expression of cytoplasmic phosphorylated CSE1L in malignant melanoma but not in benign nevi: phosphorylated CSE1L for the discrimination between melanoma and benign nevi. Int J Clin Exp Pathol. 2015-01-01 [PMID: 25973023]
• Jiang MC, Yeh CM, Tai CJ et al. CSE1L modulates Ras-induced cancer cell invasion: correlation of K-Ras mutation and CSE1L expression in colorectal cancer progression. Am J Surg. 2013-06-24 [PMID: 23806821]
• Li KK, Yang L, Pang JC et al. MIR-137 Suppresses Growth and Invasion, is Downregulated in Oligodendroglial Tumors and Targets CSE1L. Brain Pathol. 2012-12-10 [PMID: 23252729]
• Chang CC, Tai CJ, Su TC et al. The prognostic significance of nuclear CSE1L in urinary bladder urothelial carcinomas. Ann Diagn Pathol. 2012-04-02 [PMID: 22476051]
• Uen WC, Tai CJ, Shen SC et al. Differential distributions of CSE1L/CAS and E-cadherin in the polarized and non-polarized epithelial glands of neoplastic colorectal epithelium. J Mol Histol. 2010-08-24 [PMID: 20734115]
• Stella Tsai CS, Chen HC, Tung JN et al. Serum cellular apoptosis susceptibility protein is a potential prognostic marker for metastatic colorectal cancer. Am J Pathol. 2010-01-01 [PMID: 20150437]
• Tung MC, Tsai CS, Tung JN et al. Higher Prevalence of Secretory CSE1L/CAS in Sera of Patients with Metastatic Cancer. Cancer Epidemiol Biomarkers Prev. 2009-05-01 [PMID: 19383891]
• Tsao TY, Tsai CS, Tung JN et al. Function of CSE1L/CAS in the secretion of HT-29 human colorectal cells and its expression in human colon. Mol Cell Biochem. 2009-02-18 [PMID: 19224336]

Review for CSE1L/CAS/Exportin-2 Antibody (H00001434-M08) (1)

Average Rating: 5

(Based on 1 review)

We have 1 review tested in 1 species: Mouse.

reviewed by: Michael Nowak IHC-P Mouse 12/09/2021

Summary

• Application: Immunohistochemistry-Paraffin
• Sample Tested: Prostate tissue
• Species: Mouse
• Lot: 3D8

Comments

• Comments: Incubated samples with the primary antibody for 10 hours

Bioinformatics

• Gene Symbol: CSE1L
• Entrez:
  • 1434(Human)
• OMIM:
  • 601342(Human)
• Uniprot:
  • NP_001307(Human)