SARDH Antibody

Images

 
Western Blot: SARDH Antibody [NBP2-31668] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunohistochemistry-Paraffin: SARDH Antibody [NBP2-31668] - Staining of human stomach, upper shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SARDH Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: RERSHESYAKNYSVVFPHDEPLAGRNMRRDPLHEELLGQGCVFQERHGWERPGWFHPRGPAPVLEYDYYGAYGSRAHEDYAYRRLLADEYTFAFPPHHDTIKKEC
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SARDH
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:250 - 1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SARDH Protein (NBP2-31668PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SARDH Antibody

  • BPR-2
  • dimethylglycine dehydrogenase-like 1
  • DMGDHL1
  • FLJ36475
  • mitochondrial
  • SAR
  • sarcosine dehydrogenase
  • SARD
  • SDH

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02126
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NBP1-87069
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
NBP2-57614
Species: Hu
Applications: ICC/IF
NBP1-92372
Species: Hu
Applications: IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP1-32259
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-07799
Species: Hu
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00006391-M01
Species: Hu
Applications: WB, ELISA, IHC-P

Publications for SARDH Antibody (NBP2-31668) (0)

There are no publications for SARDH Antibody (NBP2-31668).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SARDH Antibody (NBP2-31668) (0)

There are no reviews for SARDH Antibody (NBP2-31668). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SARDH Antibody (NBP2-31668) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SARDH Products

SARDH NBP2-31668

Bioinformatics Tool for SARDH Antibody (NBP2-31668)

Discover related pathways, diseases and genes to SARDH Antibody (NBP2-31668). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SARDH Antibody (NBP2-31668)

Discover more about diseases related to SARDH Antibody (NBP2-31668).
 

Pathways for SARDH Antibody (NBP2-31668)

View related products by pathway.

PTMs for SARDH Antibody (NBP2-31668)

Learn more about PTMs related to SARDH Antibody (NBP2-31668).

Blogs on SARDH

There are no specific blogs for SARDH, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SARDH Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SARDH
Uniprot