SALL4 Antibody (6E3)

Images

 
Western Blot: SALL4 Antibody (6E3) [H00057167-M03] - Analysis of SALL4 expression in Hela S3 NE (Cat # L013V3).
Immunohistochemistry-Paraffin: SALL4 Antibody (6E3) [H00057167-M03] - Analysis of monoclonal antibody to SALL4 on formalin-fixed paraffin-embedded human testis. Antibody concentration 0.2 ug/ml
Western Blot: SALL4 Antibody (6E3) [H00057167-M03] - Analysis of SALL4 expression in NIH/3T3 (Cat # L018V1).
ELISA: SALL4 Antibody (6E3) [H00057167-M03] - Detection limit for recombinant GST tagged SALL4 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
Clone
6E3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SALL4 Antibody (6E3) Summary

Immunogen
SALL4 (NP_065169, 954 a.a. ~ 1053 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PKEILAPSVNVDPVVWNQYTSMLNGGLAVKTNEISVIQSGGVPTLPVSLGATSVVNNATVSKMDGSQSGISADVEKPSATDGVPKHQFPHFLEENKIAVS
Specificity
SALL4 (6E3)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SALL4
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • Chromatin Immunoprecipitation
  • ELISA 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence 1:10-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Sandwich ELISA
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA. Use in chromatin immunoprecipitation and Immunocytochemistry/immunofluorescence reported in scientific literature (PMID 24163373)
Publications
Read Publications using
H00057167-M03 in the following applications:

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SALL4 Antibody (6E3)

  • dJ1112F19.1
  • DRRS
  • HSAL4
  • MGC133050
  • SALL4
  • sal-like 4 (Drosophila)
  • sal-like protein 4
  • Zinc finger protein 797
  • Zinc finger protein SALL4
  • ZNF797
  • ZNF797sal (Drosophila)-like 4

Background

The protein encoded by this gene may be a zinc finger transcription factor. Defects in this gene are a cause of Duane-radial ray syndrome (DRRS).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2379
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, Flow, ICC/IF, IHC
H00388112-B01P
Species: Hu
Applications: WB
AF1997
Species: Hu
Applications: WB, ChIP, ICC
MAB2018
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-reported, ICC, ICFlow
PP-K9814-00
Species: Hu
Applications: WB, IHC, IP
NBP2-37483
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-83237
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF3158
Species: Mu
Applications: WB, IHC, ChIP, ICC
MAB1368
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow, KO
AF3757
Species: Hu
Applications: WB, ICC
NB600-302
Species: Hu, Mu, Dr
Applications: WB, Simple Western, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-47594
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-2136
Species: Hu
Applications: WB (-), IHC, IHC-P, IP
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
AF4847
Species: Hu
Applications: WB, ICC
H00057167-M03
Species: Hu, Mu, Rt
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, S-ELISA

Publications for SALL4 Antibody (H00057167-M03)(28)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 3 applications: ChIP, ICC/IF, WB.


Filter By Application
ChIP
(1)
ICC/IF
(1)
WB
(2)
All Applications
Filter By Species
Mouse
(1)
All Species
Showing Publications 1 - 10 of 28. Show All 28 Publications.
Publications using H00057167-M03 Applications Species
Yamada R, Horiguchi SI, Onishi T et al. Early Gastric Cancer with Purely Enteroblastic Differentiation and No Conventional Adenocarcinoma Component. Case Rep Pathol Aug 28 2018 [PMID: 30228922]
Fujimoto M, Matsuzaki I, Nishino M et al. HER2 is frequently overexpressed in hepatoid adenocarcinoma and gastric carcinoma with enteroblastic differentiation: a comparison of 35 cases to 334 gastric carcinomas of other histological types. J Clin Pathol Jan 5 2018 [PMID: 29305518]
Shi H, Xu X, Zhang B et al. 3,3'-Diindolylmethane stimulates exosomal Wnt11 autocrine signaling in human umbilical cord mesenchymal stem cells to enhance wound healing. Theranostics Apr 10 2017 [PMID: 28529644]
Yoshida A, Kobayashi E, Kubo T et al. Clinicopathological and molecular characterization of SMARCA4-deficient thoracic sarcomas with comparison to potentially related entities. Mod Pathol 2017 Mar 3 [PMID: 28256572]
Terada Y, Jo N, Arakawa Y et al. Human Pluripotent Stem Cell-Derived Tumor Model Uncovers the Embryonic Stem Cell Signature as a Key Driver in Atypical Teratoid/Rhabdoid Tumor. Cell Rep. 2019 Mar 05 [PMID: 30840885]
Matsumoto K, Ueyama H, Matsumoto K et al. Clinicopathological features of alpha-fetoprotein producing early gastric cancer with enteroblastic differentiation. World J Gastroenterol 2016 Sep 28 [PMID: 27688662]
Bie Q, Sun C, Gong A et al. Non-tumor tissue derived interleukin-17B activates IL-17RB/AKT/beta-catenin pathway to enhance the stemness of gastric cancer. Sci Rep 2016 May 05 [PMID: 27146881] (WB) WB
Kilic E, Tennstedt P, Hogner A et al. The zinc-finger transcription factor SALL4 is frequently expressed in human cancers: association with clinical outcome in squamous cell carcinoma but not in adenocarcinoma of the esophagus. Virchows Arch 2016 Jan 27 [PMID: 26818834]
Chapman KM, Medrano GA, Chaudhary J, Hamra FK. NRG1 and KITL signal downstream of retinoic acid in the germline to support soma-free syncytial growth of differentiating spermatogonia. Cell Death Discov. 2015 Oct 05 [PMID: 26500786]
Show All 28 Publications.

Reviews for SALL4 Antibody (H00057167-M03) (0)

There are no reviews for SALL4 Antibody (H00057167-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Video Protocols

WB Video Protocol
ChIP Video Protocol
ChIP Webinar
ICC/IF Video Protocol

FAQs for SALL4 Antibody (H00057167-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SALL4 Products

Bioinformatics Tool for SALL4 Antibody (H00057167-M03)

Discover related pathways, diseases and genes to SALL4 Antibody (H00057167-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SALL4 Antibody (H00057167-M03)

Discover more about diseases related to SALL4 Antibody (H00057167-M03).
 

Pathways for SALL4 Antibody (H00057167-M03)

View related products by pathway.

PTMs for SALL4 Antibody (H00057167-M03)

Learn more about PTMs related to SALL4 Antibody (H00057167-M03).

Blogs on SALL4

There are no specific blogs for SALL4, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SALL4 Antibody (6E3) and receive a gift card or discount.

Bioinformatics

Gene Symbol SALL4
Entrez
OMIM
Uniprot