S5a/Angiocidin Antibody

Images

 
Western Blot: S5a/Angiocidin Antibody [NBP2-37888] - Analysis in control (vector only transfected HEK293T lysate) and PSMD4 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian ...read more
Immunocytochemistry/ Immunofluorescence: S5a/Angiocidin Antibody [NBP2-37888] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: S5a/Angiocidin Antibody [NBP2-37888] - Staining of human liver.
Immunohistochemistry-Paraffin: S5a/Angiocidin Antibody [NBP2-37888] - Staining of human testis shows strong cytoplasmic and nuclear positivity in cells in seminiferous ducts.
Independent Antibodies: Immunohistochemistry-Paraffin: S5a/Angiocidin Antibody [NBP2-37888] - Staining of human cerebral cortex, liver, lymph node and testis using Anti-PSMD4 antibody NBP2-37888 (A) shows similar ...read more
Immunohistochemistry-Paraffin: S5a/Angiocidin Antibody [NBP2-37888] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: S5a/Angiocidin Antibody [NBP2-37888] - Staining of human testis.
Immunohistochemistry-Paraffin: S5a/Angiocidin Antibody [NBP2-37888] - Staining of human lymph node.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

S5a/Angiocidin Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: AESADIDASSAMDTSEPAKEEDDYDVMQDPEFLQSVLENLPGVDPNNEAIRNA
Predicted Species
Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PSMD4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
S5a/Angiocidin Recombinant Protein Antigen (NBP2-37888PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for S5a/Angiocidin Antibody

  • Angiocidin
  • ASF
  • Macropain
  • Mcb1
  • PSMD4
  • pUB-R5
  • Rpn10
  • S5a

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20324
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-66861
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF6387
Species: Hu
Applications: WB
NBP2-47290
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
D6050
Species: Hu
Applications: ELISA
H00010921-M05
Species: Hu, Mu, Rt
Applications: ELISA, IP, WB
NB300-560
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
MAB1368
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow, KO, Simple Western, WB
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-672
Species: Bv, Ca, Hu, Mu
Applications: ELISA, ICC/IF, IHC, IP, KD, MiAr, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NB100-1756
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-37888
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for S5a/Angiocidin Antibody (NBP2-37888) (0)

There are no publications for S5a/Angiocidin Antibody (NBP2-37888).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for S5a/Angiocidin Antibody (NBP2-37888) (0)

There are no reviews for S5a/Angiocidin Antibody (NBP2-37888). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for S5a/Angiocidin Antibody (NBP2-37888) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional S5a/Angiocidin Products

Bioinformatics Tool for S5a/Angiocidin Antibody (NBP2-37888)

Discover related pathways, diseases and genes to S5a/Angiocidin Antibody (NBP2-37888). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for S5a/Angiocidin Antibody (NBP2-37888)

Discover more about diseases related to S5a/Angiocidin Antibody (NBP2-37888).
 

Pathways for S5a/Angiocidin Antibody (NBP2-37888)

View related products by pathway.

PTMs for S5a/Angiocidin Antibody (NBP2-37888)

Learn more about PTMs related to S5a/Angiocidin Antibody (NBP2-37888).
 

Research Areas for S5a/Angiocidin Antibody (NBP2-37888)

Find related products by research area.

Blogs on S5a/Angiocidin

There are no specific blogs for S5a/Angiocidin, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our S5a/Angiocidin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PSMD4
Uniprot