RNPS1 Antibody (7G8)


Western Blot: RNPS1 Antibody (7G8) [H00010921-M05] - Analysis of RNPS1 expression in rat testis.
Western Blot: RNPS1 Antibody (7G8) [H00010921-M05] - Analysis of RNPS1 expression in HeLa.
Western Blot: RNPS1 Antibody (7G8) [H00010921-M05] - Analysis of RNPS1 expression in PC-12.
Western Blot: RNPS1 Antibody (7G8) [H00010921-M05] - Analysis of RNPS1 expression in 293.
Western Blot: RNPS1 Antibody (7G8) [H00010921-M05] - Analysis of RNPS1 expression in Raw 264.7.
Western Blot: RNPS1 Antibody (7G8) [H00010921-M05] - Analysis of RNPS1 expression in human kidney.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, IP

Order Details

RNPS1 Antibody (7G8) Summary

RNPS1 (NP_006702, 158 a.a. ~ 239 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PKPTKVHIGRLTRNVTKDHIMEIFSTYGKIKMIDMPVERMHPHLSKGYAYVEFENPDEAEKALKHMDGGQIDGQEITATAVL
RNPS1 - RNA binding protein S1, serine-rich domain (7G8)
IgG2a Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:500
  • Immunoprecipitation
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. Use in immunprecipitation reported in scientific literature (PMID 22672905)
Read Publication using
H00010921-M05 in the following applications:

  • IP
    1 publication
  • WB
    1 publication

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
In 1x PBS, pH 7.4
No Preservative
IgG purified


This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RNPS1 Antibody (7G8)

  • E5.1
  • LDC2
  • MGC117332
  • RNA binding protein S1, serine-rich domain
  • RNA-binding protein S1, serine-rich domain
  • RNA-binding protein with serine-rich domain 1
  • SR protein
  • SR-related protein LDC2


This gene encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons. This protein binds to the mRNA and remains bound after nuclear export, acting as a nucleocytoplasmic shuttling protein. This protein contains many serine residues. Two splice variants have been found for this gene; both variants encode the same protein.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Am, Dr
Applications: WB, EM, ELISA, ICC/IF, IHC-Fr, IHC-P, IP, IHC-FrFl, KO
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IP
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, IP

Publications for RNPS1 Antibody (H00010921-M05)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: IP, WB.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for RNPS1 Antibody (H00010921-M05) (0)

There are no reviews for RNPS1 Antibody (H00010921-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RNPS1 Antibody (H00010921-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional RNPS1 Products

Bioinformatics Tool for RNPS1 Antibody (H00010921-M05)

Discover related pathways, diseases and genes to RNPS1 Antibody (H00010921-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RNPS1 Antibody (H00010921-M05)

Discover more about diseases related to RNPS1 Antibody (H00010921-M05).

Pathways for RNPS1 Antibody (H00010921-M05)

View related products by pathway.

PTMs for RNPS1 Antibody (H00010921-M05)

Learn more about PTMs related to RNPS1 Antibody (H00010921-M05).

Research Areas for RNPS1 Antibody (H00010921-M05)

Find related products by research area.

Blogs on RNPS1

There are no specific blogs for RNPS1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our RNPS1 Antibody (7G8) and receive a gift card or discount.


Gene Symbol RNPS1