Reactivity | Hu, Mu, RtSpecies Glossary |
Applications | WB, ELISA, IP |
Clone | 7G8 |
Clonality | Monoclonal |
Host | Mouse |
Conjugate | Unconjugated |
Immunogen | RNPS1 (NP_006702, 158 a.a. ~ 239 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PKPTKVHIGRLTRNVTKDHIMEIFSTYGKIKMIDMPVERMHPHLSKGYAYVEFENPDEAEKALKHMDGGQIDGQEITATAVL |
Specificity | RNPS1 - RNA binding protein S1, serine-rich domain (7G8) |
Isotype | IgG2a Kappa |
Clonality | Monoclonal |
Host | Mouse |
Gene | RNPS1 |
Purity | IgG purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
|
Application Notes | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. Use in immunprecipitation reported in scientific literature (PMID 22672905) |
|
Publications |
|
Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer | In 1x PBS, pH 7.4 |
Preservative | No Preservative |
Purity | IgG purified |
Publication using H00010921-M05 | Applications | Species |
---|---|---|
Huang Y, Jeong JS, Okamura J et al. Global tumor protein p53/p63 interactome: making a case for cisplatin chemoresistance. Cell Cycle 2012-06-15 [PMID: 22672905] (IP, WB, Human) | IP, WB | Human |
Secondary Antibodies |
Isotype Controls |
Diseases for RNPS1 Antibody (H00010921-M05)Discover more about diseases related to RNPS1 Antibody (H00010921-M05).
| Pathways for RNPS1 Antibody (H00010921-M05)View related products by pathway.
|
PTMs for RNPS1 Antibody (H00010921-M05)Learn more about PTMs related to RNPS1 Antibody (H00010921-M05).
| Research Areas for RNPS1 Antibody (H00010921-M05)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.