RNPS1 Antibody (7G8)

Western Blot: RNPS1 Antibody (7G8) [H00010921-M05] - Analysis of RNPS1 expression in rat testis.

Western Blot: RNPS1 Antibody (7G8) [H00010921-M05] - Analysis of RNPS1 expression in HeLa.

Western Blot: RNPS1 Antibody (7G8) [H00010921-M05] - Analysis of RNPS1 expression in PC-12.

Western Blot: RNPS1 Antibody (7G8) [H00010921-M05] - Analysis of RNPS1 expression in 293.

Western Blot: RNPS1 Antibody (7G8) [H00010921-M05] - Analysis of RNPS1 expression in Raw 264.7.

Western Blot: RNPS1 Antibody (7G8) [H00010921-M05] - Analysis of RNPS1 expression in human kidney.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, IP
• Clone: 7G8
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated

RNPS1 Antibody (7G8) Summary

• Immunogen: RNPS1 (NP_006702, 158 a.a. ~ 239 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PKPTKVHIGRLTRNVTKDHIMEIFSTYGKIKMIDMPVERMHPHLSKGYAYVEFENPDEAEKALKHMDGGQIDGQEITATAVL
• Specificity: RNPS1 - RNA binding protein S1, serine-rich domain (7G8)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: RNPS1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoprecipitation
  • Western Blot 1:500
• Application Notes: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. Use in immunprecipitation reported in scientific literature (PMID 22672905)

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RNPS1 Antibody (7G8)

• E5.1
• LDC2
• MGC117332
• RNA binding protein S1, serine-rich domain
• RNA-binding protein S1, serine-rich domain
• RNA-binding protein with serine-rich domain 1
• SR protein
• SR-related protein LDC2

Background

This gene encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons. This protein binds to the mRNA and remains bound after nuclear export, acting as a nucleocytoplasmic shuttling protein. This protein contains many serine residues. Two splice variants have been found for this gene; both variants encode the same protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RNPS1 Antibody (H00010921-M05)(1)

Publication using H00010921-M05

• Huang Y, Jeong JS, Okamura J et al. Global tumor protein p53/p63 interactome: making a case for cisplatin chemoresistance. Cell Cycle 2012-06-15 [PMID: 22672905] (IP, WB, Human)

Bioinformatics

• Gene Symbol: RNPS1
• Entrez:
  • 10921(Human)
• Uniprot:
  • NP_006702(Human)