S100A7/Psoriasin Antibody - BSA Free

Immunohistochemistry: S100A7/Psoriasin Antibody [NBP1-87205] - Zn-binding protein immunohistochemical staining in OPSCC. Examples from nanozoomer digitized scans (20X magnification) of low, moderate and high cytoplasmic staining of OPSCC tumor tissue for the Zn-binding proteins AZGP1, Lipocalin-1, serum Albumin, S100A7, S100A8 and S100A9. Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/s41598-019-53268-1), licensed under a CC-BY license.

Immunohistochemistry-Paraffin: S100A7/Psoriasin Antibody [NBP1-87205] - Staining of human skin shows strong nuclear and cytoplasmic positivity in a subset of epidermal cells.

Immunohistochemistry: S100A7/Psoriasin Antibody [NBP1-87205] - Zn-binding protein immunohistochemical staining in OPSCC. Examples from nanozoomer digitized scans (20X magnification) of low, moderate & high cytoplasmic staining of OPSCC tumor tissue for the Zn-binding proteins AZGP1, Lipocalin-1, serum Albumin, S100A7, S100A8 & S100A9. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31740720), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

S100A7/Psoriasin Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit S100A7/Psoriasin Antibody - BSA Free (NBP1-87205) is a polyclonal antibody validated for use in IHC. Anti-S100A7/Psoriasin Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: EKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: S100A7
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  S100A7/Psoriasin Protein (NBP1-87205PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for S100A7/Psoriasin Antibody - BSA Free

• HID 5
• HID5
• HID-5
• protein S100-A7
• PSOR1
• psoriasin 1
• Psoriasin
• S100 calcium binding protein A7 (psoriasin 1)
• S100 calcium binding protein A7
• S100 calcium-binding protein A7 (psoriasin 1)
• S100 calcium-binding protein A7
• S100A7
• S100A7c

Background

Psoriasin / S100A7 is encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein differs from the other S100 proteins of known structure in its lack of calcium binding ability in one EF-hand at the N-terminus. This protein is markedly over-expressed in the skin lesions of psoriatic patients, but is excluded as a candidate gene for familial psoriasis susceptibility. The exact function of this protein is not known.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for S100A7/Psoriasin Antibody (NBP1-87205)(1)

Publication using NBP1-87205

• Poropatich K, Paunesku T, Zander A et al. Elemental Zn and its Binding Protein Zinc-alpha 2-Glycoprotein are Elevated in HPV-Positive Oropharyngeal Squamous Cell Carcinoma Sci Rep 2019-11-18 [PMID: 31740720] (IHC-P, Human)

Bioinformatics

• Gene Symbol: S100A7
• Entrez:
  • 6278(Human)
• Uniprot:
  • P31151()