S100A7/Psoriasin Antibody


Immunocytochemistry/ Immunofluorescence: Psoriasin/S100A7 Antibody [NBP1-87205] - Staining of human cell line U-2 OS shows positivity in cytoplasm.
Immunohistochemistry-Paraffin: Psoriasin/S100A7 Antibody [NBP1-87205] - Staining of human skin shows strong nuclear and cytoplasmic positivity in a subset of epidermal cells.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

S100A7/Psoriasin Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: EKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCS
Specificity of human S100A7/Psoriasin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
S100A7/Psoriasin Protein (NBP1-87205PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for S100A7/Psoriasin Antibody

  • HID 5
  • HID5
  • HID-5
  • protein S100-A7
  • PSOR1
  • psoriasin 1
  • Psoriasin
  • S100 calcium binding protein A7 (psoriasin 1)
  • S100 calcium binding protein A7
  • S100 calcium-binding protein A7 (psoriasin 1)
  • S100 calcium-binding protein A7
  • S100A7
  • S100A7c


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Mu
Applications: WB, Simple Western, IHC, ICC
Species: Mu
Applications: WB, Simple Western, ICC
Species: Hu
Applications: WB, IHC
Species: Mu
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, Simple Western, IHC
Species: Hu
Applications: WB, ICC
Species: Hu, Mu, Rt, Dr
Applications: WB, ICC/IF, IHC, IP
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow
Species: Hu
Applications: WB, IHC
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, IHC
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for Psoriasin/S100A7 Antibody (NBP1-87205) (0)

There are no publications for Psoriasin/S100A7 Antibody (NBP1-87205).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Psoriasin/S100A7 Antibody (NBP1-87205) (0)

There are no reviews for Psoriasin/S100A7 Antibody (NBP1-87205). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Psoriasin/S100A7 Antibody (NBP1-87205) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional S100A7/Psoriasin Products

Bioinformatics Tool for Psoriasin/S100A7 Antibody (NBP1-87205)

Discover related pathways, diseases and genes to Psoriasin/S100A7 Antibody (NBP1-87205). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Psoriasin/S100A7 Antibody (NBP1-87205)

Discover more about diseases related to Psoriasin/S100A7 Antibody (NBP1-87205).

Pathways for Psoriasin/S100A7 Antibody (NBP1-87205)

View related products by pathway.

PTMs for Psoriasin/S100A7 Antibody (NBP1-87205)

Learn more about PTMs related to Psoriasin/S100A7 Antibody (NBP1-87205).

Research Areas for Psoriasin/S100A7 Antibody (NBP1-87205)

Find related products by research area.

Blogs on S100A7/Psoriasin

There are no specific blogs for S100A7/Psoriasin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our S100A7/Psoriasin Antibody and receive a gift card or discount.


Gene Symbol S100A7