S100 calcium binding protein A14 Antibody

Images

 
Western Blot: S100 calcium binding protein A14 Antibody [NBP1-90000] - Analysis in control (vector only transfected HEK293T lysate) and S100A14 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 ...read more
Immunocytochemistry/ Immunofluorescence: S100 calcium binding protein A14 Antibody [NBP1-90000] - Staining of human cell line MCF7 shows localization to nuclear bodies, plasma membrane, cytosol & cell junctions. ...read more
Orthogonal Strategies: Immunohistochemistry-Paraffin: S100 calcium binding protein A14 Antibody [NBP1-90000] - Staining in human esophagus and kidney tissues using anti-S100A14 antibody. Corresponding S100A14 ...read more
Immunohistochemistry-Paraffin: S100 calcium binding protein A14 Antibody [NBP1-90000] - Staining of human esophagus shows high expression.
Immunohistochemistry-Paraffin: S100 calcium binding protein A14 Antibody [NBP1-90000] - Staining of human kidney shows low expression as expected.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

S100 calcium binding protein A14 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GQCRSANAEDAQEFSDVERAIETLIKNFHQYSVEGGKETLTPSELRDLVTQQLPHLMPSNCGLEEKIANLGSCNDSKLEFRSFWELIGEA
Specificity
Specificity of human S100 calcium binding protein A14 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
S100A14
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
S100 calcium binding protein A14 Protein (NBP1-90000PEP)
Publications
Read Publication using
NBP1-90000 in the following applications:

  • IHC
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for S100 calcium binding protein A14 Antibody

  • protein S100-A14
  • S100 calcium binding protein A14
  • S100 calcium-binding protein A14
  • S100A15BCMP84breast cancer membrane protein 84
  • S114

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29403
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-45267
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56559
Species: Hu
Applications: WB, Simple Western, EM, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-05018
Species: Hu
H00006275-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, S-ELISA
AF3059
Species: Mu
Applications: WB, Simple Western, ICC
NB110-89726
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-79764
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PA
NB200-103
Species: Hu, Mu, Rt, Ch, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
MAB2957
Species: Hu
Applications: WB, ICC, KO
NBP2-03950
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF2377
Species: Mu
Applications: WB, Simple Western, IHC
AF4874
Species: Hu
Applications: WB, IHC
NBP1-54679
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89388
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92361
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
AF1052
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-80807
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for S100 calcium binding protein A14 Antibody (NBP1-90000)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for S100 calcium binding protein A14 Antibody (NBP1-90000) (0)

There are no reviews for S100 calcium binding protein A14 Antibody (NBP1-90000). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for S100 calcium binding protein A14 Antibody (NBP1-90000) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional S100 calcium binding protein A14 Products

Bioinformatics Tool for S100 calcium binding protein A14 Antibody (NBP1-90000)

Discover related pathways, diseases and genes to S100 calcium binding protein A14 Antibody (NBP1-90000). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for S100 calcium binding protein A14 Antibody (NBP1-90000)

Discover more about diseases related to S100 calcium binding protein A14 Antibody (NBP1-90000).
 

Pathways for S100 calcium binding protein A14 Antibody (NBP1-90000)

View related products by pathway.

PTMs for S100 calcium binding protein A14 Antibody (NBP1-90000)

Learn more about PTMs related to S100 calcium binding protein A14 Antibody (NBP1-90000).

Blogs on S100 calcium binding protein A14

There are no specific blogs for S100 calcium binding protein A14, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our S100 calcium binding protein A14 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol S100A14