S100 calcium binding protein A14 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: S100 calcium binding protein A14 Antibody [NBP1-90000] - Staining of human cell line MCF7 shows localization to nuclear bodies, cytosol & cell junctions.
Immunohistochemistry-Paraffin: S100 calcium binding protein A14 Antibody [NBP1-90000] - Staining of human vulva/anal skin shows strong cytoplasmic and membrane positivity in squamous epithelial cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

S100 calcium binding protein A14 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GQCRSANAEDAQEFSDVERAIETLIKNFHQYSVEGGKETLTPSELRDLVTQQLPHLMPSNCGLEEKIANLGSCNDSKLEFRSFWELIGEA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
S100A14
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:2500-1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
S100 calcium binding protein A14 Protein (NBP1-90000PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for S100 calcium binding protein A14 Antibody

  • protein S100-A14
  • S100 calcium binding protein A14
  • S100 calcium-binding protein A14
  • S100A15BCMP84breast cancer membrane protein 84
  • S114

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29403
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-45224
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56559
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-23450
Species: Mu
NBP2-36431
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3059
Species: Mu
Applications: WB, Simple Western, ICC
AF2065
Species: Mu
Applications: WB, Simple Western, ICC
AF4870
Species: Hu
Applications: WB, ICC
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
MAB2957
Species: Hu
Applications: WB, ICC, KO
NBP2-03950
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF2377
Species: Mu
Applications: WB, Simple Western, IHC
AF4874
Species: Hu
Applications: WB, IHC
NBP1-54679
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89388
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92361
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1052
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-80807
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for S100 calcium binding protein A14 Antibody (NBP1-90000) (0)

There are no publications for S100 calcium binding protein A14 Antibody (NBP1-90000).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for S100 calcium binding protein A14 Antibody (NBP1-90000) (0)

There are no reviews for S100 calcium binding protein A14 Antibody (NBP1-90000). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for S100 calcium binding protein A14 Antibody (NBP1-90000) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional S100 calcium binding protein A14 Products

Bioinformatics Tool for S100 calcium binding protein A14 Antibody (NBP1-90000)

Discover related pathways, diseases and genes to S100 calcium binding protein A14 Antibody (NBP1-90000). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for S100 calcium binding protein A14 Antibody (NBP1-90000)

Discover more about diseases related to S100 calcium binding protein A14 Antibody (NBP1-90000).
 

Pathways for S100 calcium binding protein A14 Antibody (NBP1-90000)

View related products by pathway.

PTMs for S100 calcium binding protein A14 Antibody (NBP1-90000)

Learn more about PTMs related to S100 calcium binding protein A14 Antibody (NBP1-90000).

Blogs on S100 calcium binding protein A14

There are no specific blogs for S100 calcium binding protein A14, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our S100 calcium binding protein A14 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol S100A14