RNASE7 Antibody

Images

 
Western Blot: RNASE7 Antibody [NBP1-86134] - Analysis in control (vector only transfected HEK293T lysate) and rNASE7 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunohistochemistry-Paraffin: RNASE7 Antibody [NBP1-86134] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RNASE7 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KGMTSSQWFKIQHMQPSPQACNSAMKNINKHTKRCKDLNTFLHEPFSSVAATCQTPKIACKNGDKNCHQSHGPVSLTMCKLTSGKYPNCRYKEKRQNKSYVVACKPPQKKDSQQFHLVPVHLDRV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RNASE7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RNASE7 Protein (NBP1-86134PEP)
Publications
Read Publication using NBP1-86134.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RNASE7 Antibody

  • EC 3.1.27
  • EC 3.1.27.-
  • EC 3.1.27.5
  • MGC133220
  • ribonuclease 7
  • ribonuclease, RNase A family, 7
  • RNase 7
  • SAP-2
  • Skin-derived antimicrobial protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2758
Species: Hu
Applications: WB, IHC
NB100-56559
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-33778
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37422
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-87092
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84505
Species: Hu
Applications: IHC, IHC-P
NBP2-01264
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56722
Species: Hu, Ca
Applications: WB, B/N, Flow, Func, ICC/IF, IHC-P, IP, Flow-CS
NBP1-30646
Species: Hu
Applications: WB, IHC, IHC-P
H00002629-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
NB600-648
Species: Bv
Applications: WB, ELISA, IP
NBP1-46781
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
H00004068-M01
Species: Hu
Applications: WB, ELISA
AF2558
Species: Hu, Mu
Applications: WB, Simple Western
NBP2-13943
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for RNASE7 Antibody (NBP1-86134)(1)


Reviews for RNASE7 Antibody (NBP1-86134) (0)

There are no reviews for RNASE7 Antibody (NBP1-86134). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RNASE7 Antibody (NBP1-86134) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RNASE7 Products

Bioinformatics Tool for RNASE7 Antibody (NBP1-86134)

Discover related pathways, diseases and genes to RNASE7 Antibody (NBP1-86134). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RNASE7 Antibody (NBP1-86134)

Discover more about diseases related to RNASE7 Antibody (NBP1-86134).
 

Pathways for RNASE7 Antibody (NBP1-86134)

View related products by pathway.

Blogs on RNASE7

There are no specific blogs for RNASE7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RNASE7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RNASE7