Hornerin Antibody

Images

 
Western Blot: Hornerin Antibody [NBP1-80807] - Hornerin expression in HCC cell lines. Western blot analysis of Hornerin expression levels in a panel of HCC cell lines. Image collected and cropped by CiteAb from the ...read more
Immunocytochemistry/ Immunofluorescence: Hornerin Antibody [NBP1-80807] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry: Hornerin Antibody [NBP1-80807] - Hornerin overpression in human HCC tumor tissues. Immunohistochemistry of Hornerin expression in hepatocellular carcinoma (HCC) tissues. Hornerin expression in the ...read more
Immunohistochemistry-Paraffin: Hornerin Antibody [NBP1-80807] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: Hornerin Antibody [NBP1-80807] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: Hornerin Antibody [NBP1-80807] - Staining of human skin shows moderate to strong cytoplasmic granular positivity in the cornified layer.
Immunohistochemistry-Paraffin: Hornerin Antibody [NBP1-80807] - Staining of human testis shows weak positivity in peritubular myoid cells.
Genetic Strategies: Knockdown Validated: Hornerin Antibody [NBP1-80807] - Hornerin expression in HCC cell lines. RNR shRNAs inhibited the expression of Hornerin in PLC/PRF/5 and QGY-7703 cells Image collected and ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

   

Order Details

Hornerin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: WSAGENDSYSRNVRGSLKPGTESISRRLSFQRDFSGQHNSYSGQSSSYGEQNSDSHQSSGRGQCGSGS
Specificity
Specificity of human Hornerin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HRNR
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04 - 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100. WB and ICC/IF were reported in (PMID: 22727333).
Control Peptide
Hornerin Protein (NBP1-80807PEP)
Publications
Read Publications using
NBP1-80807 in the following applications:

  • 1 publication
  • IHC
    3 publications
  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Hornerin Antibody

  • hornerin
  • intermediate filament-associated protein
  • S100A16
  • S100a18

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-223
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Eq
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-87528
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
AF3844
Species: Hu, Mu
Applications: IHC
NBP1-84019
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq, Gp, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-45267
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-29403
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-93477
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00051360-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP2-37892
Species: Hu
Applications: IHC, IHC-P
NBP1-33610
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-74510
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-86950
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-33742
Species: Hu
Applications: Simple Western, ICC/IF, IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
MAB9080
Species: Hu
Applications: WB
MAB9521
Species: Hu, Mu
Applications: WB, IHC, IP

Publications for Hornerin Antibody (NBP1-80807)(3)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 3 applications: ICC/IF, IHC, WB.


Filter By Application
ICC/IF
(1)
IHC
(3)
WB
(1)
All Applications
Filter By Species
Human
(2)
All Species

Reviews for Hornerin Antibody (NBP1-80807) (0)

There are no reviews for Hornerin Antibody (NBP1-80807). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Hornerin Antibody (NBP1-80807) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Hornerin Products

Bioinformatics Tool for Hornerin Antibody (NBP1-80807)

Discover related pathways, diseases and genes to Hornerin Antibody (NBP1-80807). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Hornerin Antibody (NBP1-80807)

Discover more about diseases related to Hornerin Antibody (NBP1-80807).
 

Pathways for Hornerin Antibody (NBP1-80807)

View related products by pathway.

PTMs for Hornerin Antibody (NBP1-80807)

Learn more about PTMs related to Hornerin Antibody (NBP1-80807).

Blogs on Hornerin

There are no specific blogs for Hornerin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Hornerin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HRNR
Entrez
Uniprot