Hornerin Antibody


Immunocytochemistry/ Immunofluorescence: Hornerin Antibody [NBP1-80807] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Hornerin Antibody [NBP1-80807] - Staining of human skin shows distinct positivity in granular layer cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

Hornerin Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: WSAGENDSYSRNVRGSLKPGTESISRRLSFQRDFSGQHNSYSGQSSSYGEQNSDSHQSSGRGQCGSGS
Specificity of human Hornerin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Western Blot and Immunocytochemistry Immunofluorescence were reported in (PMID: 22727333).
Control Peptide
Hornerin Protein (NBP1-80807PEP)
Read Publications using
NBP1-80807 in the following applications:

  • 1 publication
  • IHC
    2 publications
  • WB
    1 publication

Reactivity Notes

Mouse (84%), Rat (83%).

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Hornerin Antibody

  • hornerin
  • intermediate filament-associated protein
  • S100A16
  • S100a18


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF, ICC
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Po, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)

Publications for Hornerin Antibody (NBP1-80807)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 3 applications: ICC/IF, IHC, WB.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for Hornerin Antibody (NBP1-80807) (0)

There are no reviews for Hornerin Antibody (NBP1-80807). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Hornerin Antibody (NBP1-80807) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Hornerin Products

Bioinformatics Tool for Hornerin Antibody (NBP1-80807)

Discover related pathways, diseases and genes to Hornerin Antibody (NBP1-80807). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Hornerin Antibody (NBP1-80807)

Discover more about diseases related to Hornerin Antibody (NBP1-80807).

Pathways for Hornerin Antibody (NBP1-80807)

View related products by pathway.

PTMs for Hornerin Antibody (NBP1-80807)

Learn more about PTMs related to Hornerin Antibody (NBP1-80807).

Blogs on Hornerin

There are no specific blogs for Hornerin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Hornerin Antibody and receive a gift card or discount.


Gene Symbol HRNR