Home » Hornerin » Hornerin Antibodies » Hornerin Antibody

Hornerin Antibody

 (2 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: Hornerin Antibody [NBP1-80807] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.
Immunocytochemistry/ Immunofluorescence: Hornerin Antibody [NBP1-80807] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Hornerin Antibody [NBP1-80807] - Staining of human skin shows distinct positivity in granular layer cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

Hornerin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: WSAGENDSYSRNVRGSLKPGTESISRRLSFQRDFSGQHNSYSGQSSSYGEQNSDSHQSSGRGQCGSGS
Specificity
Specificity of human Hornerin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HRNR
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Western Blot and Immunocytochemistry Immunofluorescence were reported in (PMID: 22727333).
Control Peptide
Hornerin Protein (NBP1-80807PEP)
Publications
Read Publications using
NBP1-80807 in the following applications:

  • ICC/IF
    1 publication
  • IHC
    2 publications
  • WB
    1 publication

Reactivity Notes

Mouse (84%), Rat (83%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Hornerin Antibody

  • hornerin
  • intermediate filament-associated protein
  • S100A16
  • S100a18

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Vimentin Antibody
NB300-223
Immunocytochemistry/Immunofluorescence: Vimentin Antibody [NB300-223] - analysis of HeLa cell culture stained with chicken pAb to vimentin, NB300-223, dilution 1:10,000 in green, and costained with EnCor mouse mAb to actin, dilution 1:500 in red. The blue is DAPI staining of nuclear DNA. The vimentin antibody stains the intermediate filament network while the actin antibody labels the submembranous cytoskeleton, stress fibers, and bundles of actin associated with cell adhesion sites.
Vimentin Antibody [NB300-223] - Analysis of tissue and cell lysates using chicken pAb to Vimentin, NB300-223, dilution 1:5,000 in red. [1] protein standard (red), [2] rat whole brain lysate, [3] HeLa, [4] SH-SY5Y, [5] HEK293, and [6] NIH-3T3 cell lysates. NB300-223 binds to the vimentin protein showing a single band at ~50 kDa. The blot was simultaneously probed with mouse mAb to MAP2C/D, dilution 1:5,000 in green, revealing multiple bands around 280kDa that correspond to full length MAP2A/2B isotypes, and ~70kDa bands which are MAP2C/D isotypes. MAP2 isotypes are seen only in extracts containing neuronal lineage cells.
(1 Review)
(22 Publications)
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF, ICC
Filaggrin Antibody
NBP1-87527
Immunohistochemistry-Paraffin: Filaggrin Antibody [NBP1-87527] - Staining of human skin shows high expression.
Immunohistochemistry-Paraffin: Filaggrin Antibody [NBP1-87527] - Staining of paraffin embedded human skin tissue using Filaggrin antibody. Image from verified customer review.
Immunohistochemistry-Paraffin: Filaggrin Antibody [NBP1-87527] - Staining of human kidney shows low expression as expected.
(1 Review)
Species: Hu
Applications: IHC, IHC-P
Desmin Antibody
NB120-15200
Immunohistochemistry-Paraffin: Desmin Antibody [NB120-15200] - IHC analysis of Desmin in paraffin embedded and frozen E8-E11 mouse embryos. Image courtesy of product review submitted by Tara Rasmussen.
Immunohistochemistry-Paraffin: Desmin Antibody [NB120-15200] - Human skeletal muscle stained with anti-desmin antibody.
(1 Review)
(9 Publications)
Species: Hu, Mu, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Plectin Antibody
NBP1-84020
Immunocytochemistry/Immunofluorescence: Plectin Antibody [NBP1-84020] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & intermediate filaments.
Immunohistochemistry-Paraffin: Plectin Antibody [NBP1-84020] - Staining in human skeletal muscle and pancreas tissues using anti-PLEC antibody. Corresponding PLEC RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Plectin Antibody [NBP1-84020] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
GFAP Antibody
NB300-141
Immunocytochemistry/Immunofluorescence: GFAP Antibody [NB300-141] - ICC-IF analysis of mixed neuron-glial cultures using GFAP antibody NB300-141 (red) and Vimentin antibody NB300-223 (green). The fibroblastic cells contain only Vimentin and so are green. The astrocytes contain either Vimentin and GFAP (appearing golden) or predominantly GFAP (appearing red). Blue is nuclear DNA stain.
Immunocytochemistry/Immunofluorescence: GFAP Antibody [NB300-141] - Rat neurons stained with Neurofilament Heavy antibody NB300-217 (red) and GFAP antibody NB300-141 (green).
Immunocytochemistry/Immunofluorescence: GFAP Antibody [NB300-141] - Xenografted mouse brain section : astocyte and human nuclei. Image from a confirmed customer review.
(4 Reviews)
(32 Publications)
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
S100B Antibody
(15F4NB)
NBP2-45224
Western Blot: S100B Antibody (15F4NB) [NBP2-45224] - Total protein from human brain (lane 1) and mouse brain (lane 2) was separated on a 4-15% gel by SDS-PAGE, transferred to 0.2 um PVDF membrane for 30 minutes and blocked in 5% non-fat milk in TBST. The membrane was probed with 2 ug/ml anti-S100B in 1% milk and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Immunocytochemistry/Immunofluorescence: S100B Antibody (15F4NB) [NBP2-45224] - A431 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton-X100. The cells were incubated with S100B (15F4NB) at a 1:100 dilution overnight at 4 degrees Celsius and detected with Dylight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were detected with DAPI (Blue) at 2.0 ug/ml in 1X PBS. Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: S100B Antibody (15F4NB) [NBP2-45224] - Analysis using Azide Free version of NBP2-45224. S100B (15F4BN) in human brain tissue.
(1 Review)
(1 Publication)
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
S100A1 Antibody
(4C4.9)
NBP2-29403
Western Blot: S100A1 Antibody (4C4.9) [NBP2-29403] - Analysis of human brain lysate using S100 antibody at 1 ug/ml.
Immunohistochemistry-Paraffin: S100A1 Antibody (4C4.9) [NBP2-29403] - Formalin-fixed, paraffin-embedded human melanoma stained with S100 Ab (4C4.9).
Immunohistochemistry-Paraffin: S100A1 Antibody (4C4.9) [NBP2-29403] - Formalin-fixed, paraffin-embedded human melanoma stained with S100 4C4.9 antibody at 1:200 using peroxidase-conjugate and DAB chromogen. Note cytoplasmic staining.
(3 Publications)
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Trichohyalin
Antibody
NBP1-80687
Immunohistochemistry-Paraffin: Trichohyalin Antibody [NBP1-80687] - Staining of human placenta shows strong cytoplasmic and nuclear positivity in trophoblastic cells.
Species: Hu
Applications: IHC, IHC-P
MBTPS2 Antibody
(1A3)
H00051360-M01
Immunocytochemistry/Immunofluorescence: MBTPS2 Antibody (1A3) [H00051360-M01] - Analysis of monoclonal antibody to MBTPS2 on HeLa cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: MBTPS2 Antibody (1A3) [H00051360-M01] - Detection limit for recombinant GST tagged MBTPS2 is 1 ng/ml as a capture antibody.
Species: Hu
Applications: WB, ELISA, ICC/IF
Recombinant Human
MAGEH1 Protein
H00028986-P01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
alpha Desmuslin
Antibody (OTI7H6)
NBP2-46044
Western Blot: alpha Desmuslin Antibody (7H6) [NBP2-46044] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Desmuslin.
Immunohistochemistry: alpha Desmuslin Antibody (7H6) [NBP2-46044] - Analysis of Human lymphoma tissue.
Immunohistochemistry: alpha Desmuslin Antibody (7H6) [NBP2-46044] - Analysis of Carcinoma of Human liver tissue.
Species: Hu
Applications: WB, IHC
Loricrin Antibody
NBP1-33610
Western Blot: Loricrin Antibody [NBP1-33610] - Whole cell extract (30 ug) was separated by 12% SDS-PAGE, and the membrane was blotted with Loricrin antibody [N1], N-term diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: Loricrin Antibody [NBP1-33610] - Immunofluorescence: [NBP1-33610] - Analysis of methanol-fixed Hep3B, using antibody at 1:500 dilution.
Immunohistochemistry-Paraffin: Loricrin Antibody [NBP1-33610] - Paraffin-embedded HBL438 xenograft; antibody dilution 1:500.
(1 Review)
(2 Publications)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Presenilin-1
Antibody (APS 11)
NB300-749
Western Blot: Presenilin-1 Antibody (APS 11) [NB300-749] - Analysis of 25 ug of SH-SY5Y (lane 1), human brain (lane 2) and mouse brain (lane 3).
Immunocytochemistry/Immunofluorescence: Presenilin-1 Antibody (APS 11) [NB300-749] - Mouse fibroblasts.
Immunohistochemistry-Paraffin: Presenilin-1 Antibody (APS 11) [NB300-749] - Immunohistochemistry was performed on normal biopsies of deparaffinized Human liver tissue. To expose target proteins, heat induced antigen retrieval was performed using 10mM sodium citrate (pH6.0) buffer, microwaved for 8-15 minutes. Following antigen retrieval tissues were blocked in 3% BSA-PBS for 30 minutes at room temperature. Tissues were then probed at a dilution of 1:200 with a mouse monoclonal antibody recognizing Presenilin 1 or without primary antibody (negative control) overnight at 4C in a humidified chamber. Tissues were washed extensively with PBST and endogenous peroxidase activity was quenched with a peroxidase suppressor. Tissues were counterstained with hematoxylin and prepped for mounting.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Transglutaminase
3/TGM3 Antibody
NBP1-86950
Western Blot: Transglutaminase 3/TGM3 Antibody [NBP1-86950] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunohistochemistry-Paraffin: Transglutaminase 3/TGM3 Antibody [NBP1-86950] - Staining in human esophagus and colon tissues using anti-TGM3 antibody. Corresponding TGM3 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Transglutaminase 3/TGM3 Antibody [NBP1-86950] - Staining of human colon shows low expression as expected.
(1 Publication)
Species: Hu
Applications: WB, IHC, IHC-P
Involucrin
Antibody (SY5)
NB100-2727
Western Blot: Involucrin Antibody (SY5) [NB100-2727] - Involucrin from primary human epidermal keratinocyte lysates grown in low calcium (0.07 mM) for 5 days or differentiated with high calcium (1.5 mM) for 1-5 days. Block in 5% nonfat dry milk in TBST incubated at RT for 1 hr, antibody 1:500 in TBST, overnight at 4C. Image from verified customer review.
Immunohistochemistry-Paraffin: Involucrin Antibody (SY5) [NB100-2727] - Staining of human Tonsil with Involucrin Monoclonal Antibody (SY5).
(1 Review)
(1 Publication)
Species: Hu, Po, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
PCNA Antibody
(PC10)
NB500-106
Western Blot: PCNA Antibody (PC10) [NB500-106] - Whole cell protein from human HeLa, A431, mouse Neuro2A and rat PC12 cells was separated on a 4-20% gel by SDS-PAGE, transferred to 0.2 um PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 1.0 ug/ml anti-Histone h3 in block buffer and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Immunocytochemistry/Immunofluorescence: PCNA Antibody (PC10) [NB500-106] - HeLa cells were fixed and permeabilized for 10 minutes using -20C MeOH. The cells were incubated with anti-PCNA [PC10] at 5 ug/ml overnight at 4C and detected with an anti-mouse IgG Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry: PCNA Antibody (PC10) [NB500-106] - Analysis of PCNA in mouse cornea. Image courtesy of product review by Bo-Yie Chen.
(4 Reviews)
(22 Publications)
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
Desmoplakin
Antibody
NBP1-49879
Immunohistochemistry-Paraffin: Desmoplakin Antibody [NBP1-49879] - Paraffin embedded Human Heart. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
(1 Publication)
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Cathepsin L
Antibody [Unconjugate
AF952
Western blot shows 10 ng of Recombinant Human Cathepsin L (Catalog # 952-CY), Recombinant Mouse Cathepsin L (Catalog # 1515-CY), Recombinant Human Cathepsin V (Catalog # 1080-CY), Recombinant Human Cathepsin K, Recombinant Human Cathepsin S (Catalog # 1183-CY), Recombinant Human Cathepsin H (Catalog # 7516-CY), and Recombinant Human Cathepsin F. PVDF Membrane was probed with 0.1 µg/mL of Goat Anti-Human Cathepsin L Antigen Affinity-purified Polyclonal Antibody (Catalog # AF952) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for Cathepsin L at approximately 35 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 3.
Cathepsin L was detected in immersion fixed paraffin-embedded sections of human kidney using Goat Anti-Human Cathepsin L Antigen Affinity-purified Polyclonal Antibody (Catalog # AF952) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to convoluted tubules. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(6 Publications)
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)

Publications for Hornerin Antibody (NBP1-80807)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 3 applications: ICC/IF, IHC, WB.


Filter By Application
ICC/IF
(1)
IHC
(2)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for Hornerin Antibody (NBP1-80807) (0)

There are no reviews for Hornerin Antibody (NBP1-80807). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Hornerin Antibody (NBP1-80807) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Hornerin Products

Bioinformatics Tool for Hornerin Antibody (NBP1-80807)

Discover related pathways, diseases and genes to Hornerin Antibody (NBP1-80807). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Hornerin Antibody (NBP1-80807)

Discover more about diseases related to Hornerin Antibody (NBP1-80807).
 

Pathways for Hornerin Antibody (NBP1-80807)

View related products by pathway.

PTMs for Hornerin Antibody (NBP1-80807)

Learn more about PTMs related to Hornerin Antibody (NBP1-80807).

Blogs on Hornerin

There are no specific blogs for Hornerin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Hornerin Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol HRNR
Entrez
Uniprot