Western Blot: Hornerin Antibody [NBP1-80807] - Hornerin expression in HCC cell lines. Western blot analysis of Hornerin expression levels in a panel of HCC cell lines. Image collected and cropped by CiteAb from the ...read more
Immunocytochemistry/ Immunofluorescence: Hornerin Antibody [NBP1-80807] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry: Hornerin Antibody [NBP1-80807] - Hornerin overpression in human HCC tumor tissues. Immunohistochemistry of Hornerin expression in hepatocellular carcinoma (HCC) tissues. Hornerin expression in the ...read more
Immunohistochemistry-Paraffin: Hornerin Antibody [NBP1-80807] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: Hornerin Antibody [NBP1-80807] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: Hornerin Antibody [NBP1-80807] - Staining of human skin shows moderate to strong cytoplasmic granular positivity in the cornified layer.
Immunohistochemistry-Paraffin: Hornerin Antibody [NBP1-80807] - Staining of human testis shows weak positivity in peritubular myoid cells.
Genetic Strategies: Western Blot: Hornerin Antibody [NBP1-80807] - Hornerin expression in HCC cell lines. RNR shRNAs inhibited the expression of Hornerin in PLC/PRF/5 and QGY-7703 cells Image collected and ...read more
This antibody was developed against Recombinant Protein corresponding to amino acids: WSAGENDSYSRNVRGSLKPGTESISRRLSFQRDFSGQHNSYSGQSSSYGEQNSDSHQSSGRGQCGSGS
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HRNR
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified
Alternate Names for Hornerin Antibody - BSA Free
hornerin
intermediate filament-associated protein
S100A16
S100a18
Background
Hornerin may play a role in cornification
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our Hornerin Antibody - BSA Free and receive a gift card or discount.