Hornerin Antibody - BSA Free

Western Blot: Hornerin Antibody [NBP1-80807] - Hornerin expression in HCC cell lines. Western blot analysis of Hornerin expression levels in a panel of HCC cell lines. Image collected and cropped by CiteAb from the following publication (//bmccancer.biomedcentral.com/articles/10.1186/s12885-018-4719-5), licensed under a CC-BY license.

Immunocytochemistry/Immunofluorescence: Hornerin Antibody [NBP1-80807] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.

Immunohistochemistry: Hornerin Antibody [NBP1-80807] - Hornerin overpression in human HCC tumor tissues. Immunohistochemistry of Hornerin expression in hepatocellular carcinoma (HCC) tissues. Hornerin expression in the cytoplasm and membrane is scored as negative (a, e), weak (b, f), moderate (c, g), and strong (d, h). Original magnification, x 100 (a-d); x 400 (e-h) Image collected and cropped by CiteAb from the following publication (//bmccancer.biomedcentral.com/articles/10.1186/s12885-018-4719-5), licensed under a CC-BY license.

Immunohistochemistry-Paraffin: Hornerin Antibody [NBP1-80807] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Immunohistochemistry-Paraffin: Hornerin Antibody [NBP1-80807] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: Hornerin Antibody [NBP1-80807] - Staining of human skin shows moderate to strong cytoplasmic granular positivity in the cornified layer.

Immunohistochemistry-Paraffin: Hornerin Antibody [NBP1-80807] - Staining of human testis shows weak positivity in peritubular myoid cells.

Western Blot: Hornerin Antibody [NBP1-80807] - Hornerin expression in HCC cell lines. RNR shRNAs inhibited the expression of Hornerin in PLC/PRF/5 and QGY-7703 cells Image collected and cropped by CiteAb from the following publication (//bmccancer.biomedcentral.com/articles/10.1186/s12885-018-4719-5), licensed under a CC-BY license.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC, Mycoplasma
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Hornerin Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Hornerin Antibody - BSA Free (NBP1-80807) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-Hornerin Antibody: Cited in 6 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: WSAGENDSYSRNVRGSLKPGTESISRRLSFQRDFSGQHNSYSGQSSSYGEQNSDSHQSSGRGQCGSGS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HRNR
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
  • Knockdown Validated
  • Western Blot Reported in (PMID: 22727333)
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100.
• Control Peptide:

  Hornerin Protein (NBP1-80807PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Hornerin Antibody - BSA Free

• hornerin
• intermediate filament-associated protein
• S100A16
• S100a18

Background

Hornerin may play a role in cornification

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Hornerin Antibody (NBP1-80807)(6)

Publications using NBP1-80807

• Song H, Kim EH, Hong J et al. Hornerin mediates phosphorylation of the polo-box domain in Plk1 by Chk1 to induce death in mitosis Cell Death & Differentiation 2023-08-18 [PMID: 37596441] (Immunohistochemistry, Western Blot, Immunocytochemistry/ Immunofluorescence, Human)
• Atsushi F, Tomoko S, Mihoko Y et al. Chloroquine is a safe autophagy inhibitor for sustaining the expression of antioxidant enzymes in trophoblasts Journal of Reproductive Immunology 2022-11-01 [PMID: 36470134]
• Villalobos-Labra R, Liu R, Spaans F et al. Placenta-Derived Extracellular Vesicles from Preeclamptic and Healthy Pregnancies Impair ex vivo Vascular Endothelial Function Bioscience reports 2022-11-21 [PMID: 36408626]
• Fu SJ, Shen SL, Li SQ et al. Hornerin promotes tumor progression and is associated with poor prognosis in hepatocellular carcinoma BMC Cancer 2018-08-13 [PMID: 30103712] (IF/IHC, Human)
• Choi J, Kim DI, Kim J et al. Hornerin Is Involved in Breast Cancer Progression J Breast Cancer 2016-06-01 [PMID: 27382389] (IF/IHC)
• Fleming JM, Ginsburg E, Oliver SD et al. Hornerin, an S100 family protein, is functional in breast cells and aberrantly expressed in breast cancer BMC Cancer 2012-06-22 [PMID: 22727333] (ICC/IF, WB, IF/IHC, Human)

Bioinformatics

• Gene Symbol: HRNR
• Entrez:
  • 388697(Human)
• Uniprot:
  • Q86YZ3(Human)