Home » Hornerin » Hornerin Antibodies » Hornerin Antibody

Hornerin Antibody

 (3 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: Hornerin Antibody [NBP1-80807] - Hornerin expression in HCC cell lines. Western blot analysis of Hornerin expression levels in a panel of HCC cell lines. Image collected and cropped by CiteAb from the following publication (//bmccancer.biomedcentral.com/articles/10.1186/s12885-018-4719-5), licensed under a CC-BY licence.
Western Blot: Hornerin Antibody [NBP1-80807] - Hornerin expression in HCC cell lines. Western blot analysis of Hornerin expression levels in a panel of HCC cell lines. Image collected and cropped by CiteAb from the ...read more
Immunocytochemistry/ Immunofluorescence: Hornerin Antibody [NBP1-80807] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry: Hornerin Antibody [NBP1-80807] - Hornerin overpression in human HCC tumor tissues. Immunohistochemistry of Hornerin expression in hepatocellular carcinoma (HCC) tissues. Hornerin expression in the ...read more
Immunohistochemistry-Paraffin: Hornerin Antibody [NBP1-80807] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: Hornerin Antibody [NBP1-80807] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: Hornerin Antibody [NBP1-80807] - Staining of human skin shows moderate to strong cytoplasmic granular positivity in the cornified layer.
Immunohistochemistry-Paraffin: Hornerin Antibody [NBP1-80807] - Staining of human testis shows weak positivity in peritubular myoid cells.
Genetic Strategies: Knockdown Validated: Hornerin Antibody [NBP1-80807] - Hornerin expression in HCC cell lines. RNR shRNAs inhibited the expression of Hornerin in PLC/PRF/5 and QGY-7703 cells Image collected and ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

    

Order Details

100% Guarantee on every product

Hornerin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: WSAGENDSYSRNVRGSLKPGTESISRRLSFQRDFSGQHNSYSGQSSSYGEQNSDSHQSSGRGQCGSGS
Specificity
Specificity of human Hornerin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HRNR
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.04 - 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100. WB and ICC/IF were reported in (PMID: 22727333).
Control Peptide
Hornerin Protein (NBP1-80807PEP)
Publications
Read Publications using
NBP1-80807 in the following applications:

  • ICC/IF
    1 publication
  • IHC
    3 publications
  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Hornerin Antibody

  • hornerin
  • intermediate filament-associated protein
  • S100A16
  • S100a18

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Vimentin Antibody
NB300-223
Western Blot: Vimentin Antibody [NB300-223] - Analysis of tissue and cell lysates. Antibody at 1:5000 in red. [1] protein standard (red), [2] rat whole brain lysate, [3] HeLa, [4] SH-SY5Y, [5] HEK293, and [6] NIH-3T3 cell lysates. NB300-223 binds to the vimentin protein showing a single band at ~50 kDa. The blot was simultaneously probed with mouse mAb to MAP2C/D, dilution 1:5000 in green, revealing multiple bands around 280 kDa that correspond to full length MAP2A/2B isotypes, and ~70 kDa bands which are MAP2C/D isotypes. MAP2 isotypes are seen only in extracts containing neuronal lineage cells.
Immunohistochemistry: Vimentin Antibody [NB300-223] - Attenuated reactive astrocytosis after stroke in Smad1 cKO mice. Enlarged IHC images of boxed areas at the cortical peri-infarct area with the indicated reactive astrocyte markers GFAP, Nestin, and Vimentin. Enlarged images of GFAP IHC highlight the hypertrophic morphology of GFAP+ astrocytes in mutants. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0136967), licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: Vimentin Antibody [NB300-223] - Human A7 cells. Cells were fixed with 10% formalin and permeabilized with 0.1% TritonX-100. After blocking, cells were incubated with primary antibody (1:600) at 4C O/N followed with Alexa Fluor 488 labeled secondary antibody and counterstained with DAPI and Phalloidin for nuclei and F-actin respectively. Imaged with Leica TCS SP5 confocal microscope. ICC/IF image submitted by a verified customer review.
(6 Reviews)
(47 Publications)
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Eq
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Filaggrin Antibody
NBP1-87528
Immunohistochemistry-Paraffin: Filaggrin Antibody [NBP1-87528] - Analysis in human skin and liver tissues. Corresponding Filaggrin RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Filaggrin Antibody [NBP1-87528] - Staining of human gastrointestinal, liver, skin and testis using Anti-Filaggrin antibody NBP1-87528 (A) shows similar protein distribution across tissues to independent antibody NBP1-87527 (B).
Immunocytochemistry/Immunofluorescence: Filaggrin Antibody [NBP1-87528] - Staining of human cell line HaCaT shows localization to vesicles.
(1 Review)
(1 Publication)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Desmin Antibody
AF3844
Desmin was detected in immersion fixed frozen sections of mouse skeletal muscle using Human Desmin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3844) at 10 µg/mL overnight at 4 °C. Tissue was stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to z-lines. View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
Desmin was detected in immersion fixed paraffin-embedded sections of human heart using 15 µg/mL Human Desmin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3844) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific labeling was localized to the sarcoplasm of cardiomyocytes. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(2 Reviews)
(13 Publications)
Species: Hu, Mu
Applications: IHC
Plectin Antibody
NBP1-84019
Immunocytochemistry/Immunofluorescence: Plectin Antibody [NBP1-84019] - Staining of human cell line U-251 MG shows localization to cytosol, intermediate filaments and focal adhesion sites. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Plectin Antibody [NBP1-84019] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: Plectin Antibody [NBP1-84019] - Staining of human pancreas shows low expression as expected.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
GFAP Antibody
NB300-141
Immunocytochemistry/Immunofluorescence: GFAP Antibody [NB300-141] - Analysis of mixed neuron-glial cultures using GFAP antibody NB300-141 (red) and Vimentin antibody NB300-223 (green). The fibroblastic cells contain only Vimentin and so are green. The astrocytes contain either Vimentin and GFAP (appearing golden) or predominantly GFAP (appearing red). Blue is nuclear DNA stain.
Immunocytochemistry/Immunofluorescence: GFAP Antibody [NB300-141] - Rat neurons stained with Neurofilament Heavy antibody NB300-217 (red) and GFAP antibody NB300-141 (green).
Immunocytochemistry/Immunofluorescence: GFAP Antibody [NB300-141] - Xenografted mouse brain section: astocyte and human nuclei. ICC/IF image submitted by a verified customer review.
(12 Reviews)
(61 Publications)
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq, Gp, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
S100B Antibody
(15F9NB)
NBP2-45267
Western Blot: S100B Antibody (15F9NB) [NBP2-45267] - Total protein from human brain (1) and mouse brain (2) was separated on a 4-15% gel by SDS-PAGE, transferred to 0.2 um PVDF membrane for 30 minutes and blocked in 5% non-fat milk in TBST. The membrane was probed with 2 ug/ml anti-S100B in 1% milk and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Immunocytochemistry/Immunofluorescence: S100B Antibody (15F9NB) [NBP2-45267] - Analysis in A431 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton X-100. The cells were incubated with S100B (15F4NB) at a 1:100 dilution overnight at 4 degrees Celsius and detected with DyLight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were detected with DAPI (Blue) at 2.0 ug/ml in 1X PBS. Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: S100B Antibody (15F9NB) [NBP2-45267] - Analysis in human prostate tissue.
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
S100A1 Antibody
(4C4.9)
NBP2-29403
Western Blot: S100A1 Antibody (4C4.9) [NBP2-29403] - Analysis of human brain lysate using S100 antibody at 1 ug/ml.
Immunohistochemistry-Paraffin: S100A1 Antibody (4C4.9) [NBP2-29403] - Formalin-fixed, paraffin-embedded human melanoma stained with S100 Ab (4C4.9).
Immunohistochemistry-Paraffin: S100A1 Antibody (4C4.9) [NBP2-29403] - Formalin-fixed, paraffin-embedded human melanoma stained with S100 4C4.9 antibody at 1:200 using peroxidase-conjugate and DAB chromogen. Note cytoplasmic staining.
(3 Publications)
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Trichohyalin
Antibody
NBP2-93477
Western Blot: Trichohyalin Antibody [NBP2-93477] - Analysis of extracts of various cell lines, using Trichohyalin at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 60s.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MBTPS2 Antibody
(1A3)
H00051360-M01
Immunocytochemistry/Immunofluorescence: MBTPS2 Antibody (1A3) [H00051360-M01] - Analysis of monoclonal antibody to MBTPS2 on HeLa cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: MBTPS2 Antibody (1A3) [H00051360-M01] - Detection limit for recombinant GST tagged MBTPS2 is 1 ng/ml as a capture antibody.
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
Recombinant Human
MAGEH1 GST (N-Term) P ...
H00028986-P01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
alpha Desmuslin
Antibody
NBP2-37892
Immunohistochemistry-Paraffin: alpha Desmuslin Antibody [NBP2-37892] - Staining of human testis.
Immunohistochemistry-Paraffin: alpha Desmuslin Antibody [NBP2-37892] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: alpha Desmuslin Antibody [NBP2-37892] - Staining of human smooth muscle shows high expression.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P
Loricrin Antibody
NBP1-33610
Immunohistochemistry: Loricrin Antibody [NBP1-33610] - Prominent differences in the expressions of innate immune and barrier molecules between sebaceous gland poor (SGR) and sebaceous gland rich (SGP) skin regions. Representative images for immunostaining and quantification of epidermal levels of LOR in SGP and SGR skin sections. Images of negative control stainings are shown in the bottom left corner of SGP immunostainings. Size bars=100um. The graphs show the mean +/- SEM of measured protein levels (*p<0.05; **p<0.01; ***p<0.001, as determined by Mann-Whitney U-test). Image collected and cropped by CiteAb from the following publication (frontiersin.org/articles/10.3389/fimmu.2018.00424/full), licensed under a CC-BY licence.
Western Blot: Loricrin Antibody [NBP1-33610] - Whole cell extract (30 ug) was separated by 12% SDS-PAGE, and the membrane was blotted with Loricrin antibody [N1], N-term diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: Loricrin Antibody [NBP1-33610] - Analysis of methanol-fixed Hep3B, using antibody at 1:500 dilution.
(3 Reviews)
(3 Publications)
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Presenilin-1
Antibody (APS 18)
NB100-74510
Western Blot: Presenilin-1 Antibody (APS 18) [NB100-74510] - Analysis of THP-1 cell lysate.
Immunocytochemistry/Immunofluorescence: Presenilin-1 Antibody (APS 18) [NB100-74510] - Analysis of Presenilin 1 using Presenilin 1 Monoclonal antibody (APS 18) shows staining in A2058 melanoma cells. Presenilin 1 staining (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown. Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with or an antibody recognizing Presenilin 1 at a dilution of 1:20-1:100 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated.
Immunohistochemistry-Paraffin: Presenilin-1 Antibody (APS 18) [NB100-74510] - Normal biopsies of deparaffinized Human liver tissue.
(1 Review)
(5 Publications)
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Transglutaminase
3/TGM3 Antibody
NBP1-86950
Western Blot: Transglutaminase 3/TGM3 Antibody [NBP1-86950] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunohistochemistry-Paraffin: Transglutaminase 3/TGM3 Antibody [NBP1-86950] - Staining of human stomach shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: Transglutaminase 3/TGM3 Antibody [NBP1-86950] - Staining of human esophagus shows high expression.
(1 Publication)
Species: Hu
Applications: WB, IHC, IHC-P
Involucrin Antibody
NBP2-33742
Immunohistochemistry-Paraffin: Involucrin Antibody [NBP2-33742] - Staining in human esophagus and stomach tissues. Corresponding IVL RNA-seq data are presented for the same tissues.
Immunocytochemistry/Immunofluorescence: Involucrin Antibody [NBP2-33742] - Staining of human cell line HaCaT shows localization to nuclear bodies, cytosol & centrosome. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Involucrin Antibody [NBP2-33742] - Reconstructed human epidermis tissues are embedded in paraffin. Antigen retrieval: with citrate buffer. Antibody at 1:100. IHC-P image submitted by a verified customer review.
(2 Reviews)
Species: Hu
Applications: Simple Western, ICC/IF, IHC, IHC-P
PCNA Antibody
(PC10)
NB500-106
Simple Western: PCNA Antibody (PC10) [NB500-106] - Image shows a specific band for PCNA in 0.5 mg/mL of HeLa lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
Immunohistochemistry: PCNA Antibody (PC10) [NB500-106] - Development of the germinal zones in the tree shrew neocortex. Immunofluorescence for PCNA (yellow) and DAPI staining (blue) on 30 um-cryosections of E32-P1 tree shrew neocortex. The top margin of the image corresponds to the transition zone SVZ/intermediate zone. Scale bars, 50 um. VZ, ventricular zone; SVZ, subventricular zone; iSVZ, inner SVZ; oSVZ, outer SVZ. Image collected and cropped by CiteAb from the following publication (http://journal.frontiersin.org/article/10.3389/fnana.2018.00029/full), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: PCNA Antibody (PC10) [NB500-106] - Analysis of paraffin-embedded human colon carcinoma, showing nuclear localization.
(5 Reviews)
(33 Publications)
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
Desmoplakin
Antibody (824038) [Un ...
MAB9080
Western blot shows lysate of COLO 205 human colorectal adenocarcinoma cell line. PVDF membrane was probed with 0.5 µg/mL of Mouse Anti-Human Desmoplakin Monoclonal Antibody (Catalog # MAB9080) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). Specific bands were detected for Desmoplakin at approximately 260 and 330 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu
Applications: WB
Cathepsin L
Antibody (204101) [Un ...
MAB9521
Western blot shows 100 ng of Recombinant Human Cathepsin L (Catalog # 952-CY), Recombinant Mouse Cathepsin L (Catalog # 1515-CY), Recombinant Human Cathepsin V (Catalog # 1080-CY), Recombinant Human Cathepsin K, Recombinant Human Cathepsin S (Catalog # 1183-CY), Recombinant Human Cathepsin H (Catalog # 7516-CY), and Recombinant Human Cathepsin F. PVDF Membrane was probed with 1 µg/mL of Rat Anti-Human/Mouse Cathepsin L Monoclonal Antibody (Catalog # MAB9521) followed by HRP-conjugated Anti-Rat IgG Secondary Antibody (Catalog # HAF005). A specific band was detected for Cathepsin L at approximately 35 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 3.For natural samples, we recommend the use of Catalog # AF1515.
Cathepsin L was detected in immersion fixed paraffin-embedded sections of human kidney using Rat Anti-Human/Mouse Cathepsin L Monoclonal Antibody (Catalog # MAB9521) at 5 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Rat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS017) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm in tubular epithelial cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Cathepsin L was detected in immersion fixed frozen sections of mouse kidney using Rat Anti-Human/Mouse Cathepsin L Monoclonal Antibody (Catalog # MAB9521) at 8 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Rat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS017) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm in tubular epithelial cells. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
(2 Reviews)
(9 Publications)
Species: Hu, Mu
Applications: WB, IHC, IP

Publications for Hornerin Antibody (NBP1-80807)(3)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 3 applications: ICC/IF, IHC, WB.


Filter By Application
ICC/IF
(1)
IHC
(3)
WB
(1)
All Applications
Filter By Species
Human
(2)
All Species

Reviews for Hornerin Antibody (NBP1-80807) (0)

There are no reviews for Hornerin Antibody (NBP1-80807). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Hornerin Antibody (NBP1-80807) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional Hornerin Products

Bioinformatics Tool for Hornerin Antibody (NBP1-80807)

Discover related pathways, diseases and genes to Hornerin Antibody (NBP1-80807). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Hornerin Antibody (NBP1-80807)

Discover more about diseases related to Hornerin Antibody (NBP1-80807).
 

Pathways for Hornerin Antibody (NBP1-80807)

View related products by pathway.

PTMs for Hornerin Antibody (NBP1-80807)

Learn more about PTMs related to Hornerin Antibody (NBP1-80807).

Blogs on Hornerin

There are no specific blogs for Hornerin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Hornerin Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol HRNR
Entrez
Uniprot