Hornerin Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Hornerin Antibody [NBP1-80807] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemistry-Paraffin: Hornerin Antibody [NBP1-80807] - Staining of human skin shows distinct positivity in granular layer cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Hornerin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:WSAGENDSYSRNVRGSLKPGTESISRRLSFQRDFSGQHNSYSGQSSSYGEQNSDSHQSSGRGQCGSGS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HRNR
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Western Blot and Immunocytochemistry Immunofluorescence were reported in scientific literature.
Control Peptide
Hornerin Protein (NBP1-80807PEP)
Publications
Read Publications using
NBP1-80807 in the following applications:

  • 1 publication
  • IHC
    2 publications
  • WB
    1 publication

Reactivity Notes

Mouse (84%), Rat (83%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Hornerin Antibody

  • hornerin
  • intermediate filament-associated protein
  • S100A16
  • S100a18

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-87527
Species: Hu
Applications: IHC, IHC-P
NB120-15200
Species: Hu, Mu, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB120-11220
Species: Hu, Mu, Rt, Ma
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-45224
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-29403
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-80687
Species: Hu
Applications: IHC, IHC-P
H00051360-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-02508
Species: Hu
Applications: ELISA, IHC, IHC-P
NBP2-46044
Species: Hu
Applications: WB, IHC
NBP1-33610
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-749
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
AF4604
Species: Hu
Applications: WB, IHC
NB100-2727
Species: Hu, Po, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP1-49879
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
AF952
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)

Publications for Hornerin Antibody (NBP1-80807)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 3 applications: ICC/IF, IHC, WB.


Filter By Application
ICC/IF
(1)
IHC
(2)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for Hornerin Antibody (NBP1-80807) (0)

There are no reviews for Hornerin Antibody (NBP1-80807). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Hornerin Antibody (NBP1-80807) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Hornerin Products

Bioinformatics Tool for Hornerin Antibody (NBP1-80807)

Discover related pathways, diseases and genes to Hornerin Antibody (NBP1-80807). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Hornerin Antibody (NBP1-80807)

Discover more about diseases related to Hornerin Antibody (NBP1-80807).
 

Pathways for Hornerin Antibody (NBP1-80807)

View related products by pathway.

PTMs for Hornerin Antibody (NBP1-80807)

Learn more about PTMs related to Hornerin Antibody (NBP1-80807).

Blogs on Hornerin

There are no specific blogs for Hornerin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Hornerin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HRNR
Entrez
Uniprot