S100A16 Antibody - BSA Free

Immunohistochemistry-Paraffin: S100A16 Antibody [NBP1-92361] - Staining in human esophagus and pancreas tissues . Corresponding S100A16 RNA-seq data are presented for the same tissues.

Western Blot: S100A16 Antibody [NBP1-92361] - Analysis in SK-BR-3 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-S100A16 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

Immunocytochemistry/Immunofluorescence: S100A16 Antibody [NBP1-92361] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.

Western Blot: S100A16 Antibody [NBP1-92361] - Analysis in human cell lines A-431 and HEK293 using Anti-S100A16 antibody. Corresponding S100A16 RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.

Immunohistochemistry-Paraffin: S100A16 Antibody [NBP1-92361] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in a subset of glial cells.

Immunohistochemistry-Paraffin: S100A16 Antibody [NBP1-92361] - Staining of human esophagus shows strong membranous positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: S100A16 Antibody [NBP1-92361] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Immunohistochemistry-Paraffin: S100A16 Antibody [NBP1-92361] - Staining of human skin shows moderate membranous positivity in squamous epithelial cells.

Analysis in human esophagus and pancreas tissues using NBP1-92361 antibody. Corresponding S100A16 RNA-seq data are presented for the same tissues.

Analysis in SK-BR-3 cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC, Mycoplasma
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

S100A16 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit S100A16 Antibody - BSA Free (NBP1-92361) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VIVLVENFYKYVSKYSLVKNKISKSSFREMLQKELNHMLSDTGNRKAADKLIQNLDANHDGRISFDEYWTLIGGITGPIAKLIHEQEQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: S100A16
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  S100A16 Protein (NBP1-92361PEP)

Reactivity Notes

Mouse (85%), Rat (86%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for S100A16 Antibody - BSA Free

• AAG13
• Aging-associated gene 13 protein
• aging-associated protein 13
• DT1P1A7
• MGC17528
• protein S100-A16
• Protein S100-F
• S100 calcium binding protein A16
• S100A16
• S100F
• S100FS100 calcium-binding protein A16

Background

S100A16 is a gene that codes for a calcium-binding protein that is 103 amino acids long, with a weight of approximately 12 kDa. Current research is being done on diseases and disorders linked to this gene including carcinoma. S100A16 has also been shown to have interactions with S100A14, UCHL5, GABARAPL1, CERS2, and ECM1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: S100A16