RXR beta/NR2B2 Antibody

Images

 
Western Blot: RXR beta/NR2B2 Antibody [NBP1-52812] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RXR beta/NR2B2 Antibody Summary

Immunogen
Synthetic peptides corresponding to RXRB(retinoid X receptor, beta) The peptide sequence was selected from the N terminal of RXRB. Peptide sequence PGFSGPVSSPQINSTVSLPGGGSGPPEDVKPPVLGVRGLHCPPPPGGPGA.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RXRB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against RXRB and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RXR beta/NR2B2 Antibody

  • DAUDI6
  • H-2RIIBP
  • MHC class I promoter binding protein
  • NR2B2
  • NR2B2MGC1831
  • Nuclear receptor subfamily 2 group B member 2
  • RCoR-1
  • retinoic acid receptor RXR-beta
  • Retinoid X receptor beta
  • retinoid X receptor, beta
  • RXR beta
  • RXRB

Background

RXRB is a member of the retinoid X receptor (RXR) family of nuclear receptors which are involved in mediating the effects of retinoic acid (RA). This receptor forms homodimers with the retinoic acid, thyroid hormone, and vitamin D receptors, increasing both DNA binding and transcriptional function on their respective response elements. This gene encodes a member of the retinoid X receptor (RXR) family of nuclear receptors which are involved in mediating the effects of retinoic acid (RA). This receptor forms homodimers with the retinoic acid, thyroid hormone, and vitamin D receptors, increasing both DNA binding and transcriptional function on their respective response elements. The gene lies within the major histocompatibility complex (MHC) class II region on chromosome 6. An alternatively spliced transcript variant has been described, but its full length sequence has not been determined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.This gene encodes a member of the retinoid X receptor (RXR) family of nuclear receptors which are involved in mediating the effects of retinoic acid (RA). This receptor forms homodimers with the retinoic acid, thyroid hormone, and vitamin D receptors, increasing both DNA binding and transcriptional function on their respective response elements. The gene lies within the major histocompatibility complex (MHC) class II region on chromosome 6. An alternatively spliced transcript variant has been described, but its full length sequence has not been determined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PP-K8508-00
Species: Hu
Applications: WB, IHC, IP, GS
NBP2-53380
Species: Hu
Applications: ICC/IF, IHC-P, PAGE
NB200-322
Species: Hu, Mu, Rt
Applications: WB, IHC-Fr
NB200-321
Species: Hu, Rt
Applications: WB
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-43728
Species: Hu
Applications: WB, ICC/IF
NBP1-58922
Species: Hu
Applications: WB
NBP1-85309
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13893
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1028
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, ICC
NBP2-37370
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-13513
Species: Hu
Applications: WB, AG, ICC/IF, IHC, IHC-P
NBP1-84309
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-76504
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC
NBP1-59071
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-310
Species: Hu, Mu, Rt, Mk
Applications: WB, ChIP, IP, IF
NBP1-52812
Species: Hu
Applications: WB

Publications for RXR beta/NR2B2 Antibody (NBP1-52812) (0)

There are no publications for RXR beta/NR2B2 Antibody (NBP1-52812).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RXR beta/NR2B2 Antibody (NBP1-52812) (0)

There are no reviews for RXR beta/NR2B2 Antibody (NBP1-52812). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RXR beta/NR2B2 Antibody (NBP1-52812) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RXR beta/NR2B2 Products

Bioinformatics Tool for RXR beta/NR2B2 Antibody (NBP1-52812)

Discover related pathways, diseases and genes to RXR beta/NR2B2 Antibody (NBP1-52812). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RXR beta/NR2B2 Antibody (NBP1-52812)

Discover more about diseases related to RXR beta/NR2B2 Antibody (NBP1-52812).
 

Pathways for RXR beta/NR2B2 Antibody (NBP1-52812)

View related products by pathway.

PTMs for RXR beta/NR2B2 Antibody (NBP1-52812)

Learn more about PTMs related to RXR beta/NR2B2 Antibody (NBP1-52812).
 

Research Areas for RXR beta/NR2B2 Antibody (NBP1-52812)

Find related products by research area.

Blogs on RXR beta/NR2B2

There are no specific blogs for RXR beta/NR2B2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RXR beta/NR2B2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RXRB
Entrez
Uniprot