Daxx Antibody

Images

 
Western Blot: Daxx Antibody [NBP1-85309] - Analysis in HEK293 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-DAXX antibody. Remaining relative intensity is presented. Loading ...read more
Immunohistochemistry-Paraffin: Daxx Antibody [NBP1-85309] - Staining of human skin shows moderate nuclear positivity in squamous epithelial cells.
Western Blot: Daxx Antibody [NBP1-85309] - Analysis in human cell line HEK 293.
Immunohistochemistry-Paraffin: Daxx Antibody [NBP1-85309] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts and in Leydig cells.
Immunohistochemistry-Paraffin: Daxx Antibody [NBP1-85309] - Staining of human tonsil shows moderate to strong nuclear positivity in lymphoid cells.
Immunohistochemistry-Paraffin: Daxx Antibody [NBP1-85309] - Staining of human fallopian tube shows moderate to strong nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
     

Genetic Strategies

   

Order Details

Daxx Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DEEEEAAAGKDGDKSPMSSLQISNEKNLEPGKQISRSSGEQQNKGRIVSPSLLSEEPLAPSSIDAESNGEQPEELTLEEESPVSQLFELEIEALPLDTPSSVETDISSSRKQSEEPFTTVLENGAGMVSSTSFNGGVSPHNWGDSG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DAXX
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Daxx Protein (NBP1-85309PEP)
Publications
Read Publications using
NBP1-85309 in the following applications:

  • IHC
    3 publications
  • WB
    1 publication

Reactivity Notes

Reactivity reported in scientific literature (PMID: 21719641)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Daxx Antibody

  • BING2
  • CENP-C binding protein
  • DAP6
  • DAP6MGC126245
  • Daxx
  • death domain-associated protein 6
  • death-associated protein 6
  • death-domain associated protein
  • EAP1
  • ETS1-associated protein 1
  • Fas death domain-associated protein
  • Fas-binding protein
  • hDaxx
  • MGC126246

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-59787
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP, PLA
NB100-56077
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-86060
Species: Hu
Applications: WB, IHC, IHC-P, Micro
NBP1-81831
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83077
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56116
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-47839
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-91031
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
126-FL/CF
Species: Hu
NBP2-32972
Species: Hu, Mu, Rt, Ch, Pm, Sh
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE

Publications for Daxx Antibody (NBP1-85309)(8)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: IHC, WB.


Filter By Application
IHC
(3)
WB
(1)
All Applications
Filter By Species
Human
(4)
All Species
Showing Publications 1 - 8 of 8.
Publications using NBP1-85309 Applications Species
Masayuki Yoshida, Reiko Ogawa, Hiroshi Yoshida et al. TERT promoter mutations are frequent and show association with MED12 mutations in phyllodes tumors of the breast. British Journal of Cancer 2015 Sep 10 [PMID: 26355235] (IHC, Human) IHC Human
Napier CE, Huschtscha LI, Harvey A et al. ATRX represses alternative lengthening of telomeres. Oncotarget 2015 Jun 30 [PMID: 26001292] (WB, Human) WB Human
Pipinikas CP, Dibra H, Karpathakis A et al. Epigenetic dysregulation and poorer prognosis in DAXX-deficient pancreatic neuroendocrine tumours. Endocr Relat Cancer 2015 Jun [PMID: 25900181] (IHC, Human) IHC Human
Fishbein L, Khare S, Wubbenhorst B et al. Whole exome sequencing identifies somatic ATRX mutations in pheochromocytomas and paragangliomas. Nat Commun 2015 Jan 21 [PMID: 25608029] (IHC, Human) IHC Human
Stepp WH, Meyers JM, McBride AA. Sp100 Provides Intrinsic Immunity against Human Papillomavirus Infection. mBio 2013 Nov 5 [PMID: 24194542]
de Wilde RF, Heaphy CM, Maitra A et al. Loss of ATRX or DAXX expression and concomitant acquisition of the alternative lengthening of telomeres phenotype are late events in a small subset of MEN-1 syndrome pancreatic neuroendocrine tumors. Mod Pathol 2012 Jul [PMID: 22575867]
Schwartzentruber J, Korshunov A, Liu XY et al. Driver mutations in histone H3.3 and chromatin remodelling genes in paediatric glioblastoma. Nature 2012 Jan 29 [PMID: 22286061]
Heaphy CM, de Wilde RF, Jiao Y et al. Altered telomeres in tumors with ATRX and DAXX mutations. Science 2011 Jul 22 [PMID: 21719641]

Reviews for Daxx Antibody (NBP1-85309) (0)

There are no reviews for Daxx Antibody (NBP1-85309). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Daxx Antibody (NBP1-85309) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Daxx Products

Bioinformatics Tool for Daxx Antibody (NBP1-85309)

Discover related pathways, diseases and genes to Daxx Antibody (NBP1-85309). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Daxx Antibody (NBP1-85309)

Discover more about diseases related to Daxx Antibody (NBP1-85309).
 

Pathways for Daxx Antibody (NBP1-85309)

View related products by pathway.

PTMs for Daxx Antibody (NBP1-85309)

Learn more about PTMs related to Daxx Antibody (NBP1-85309).
 

Research Areas for Daxx Antibody (NBP1-85309)

Find related products by research area.

Blogs on Daxx

There are no specific blogs for Daxx, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Daxx Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DAXX
Entrez