HSD17B8 Antibody

Images

 
Western Blot: HSD17B8 Antibody [NBP1-84309] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunohistochemistry-Paraffin: HSD17B8 Antibody [NBP1-84309] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HSD17B8 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKVPQKVVDKITEMIPMGHLGDPEDVADVVAFLASEDSGY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HSD17B8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
HSD17B8 Protein (NBP1-84309PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HSD17B8 Antibody

  • D6S2245EdJ1033B10.9
  • EC 1.1.1.-
  • EC 1.1.1.62
  • EC 1.1.1.63,17-beta-HSD 8
  • estrogen 17-oxidoreductase
  • FABGLestradiol 17-beta-dehydrogenase 8
  • H2-KE6
  • HKE6FabG (beta-ketoacyl-[acyl-carrier-protein] reductase, E coli) like (E. coli)
  • hydroxysteroid (17-beta) dehydrogenase 8,3-oxoacyl-[acyl-carrier-protein] reductase
  • KE6
  • ke-6
  • Ke-6,17-beta-hydroxysteroid dehydrogenase 8
  • Protein Ke6
  • Really interesting new gene 2 protein
  • RING2FABG
  • SDR30C1
  • short chain dehydrogenase/reductase family 30C, member 1
  • Testosterone 17-beta-dehydrogenase 8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-76504
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-37370
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
NBP1-31682
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33748
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-83936
Species: Hu
Applications: WB, IHC, IHC-P
H00009223-M03
Species: Hu, Rt, Ca, Ha
Applications: WB, ELISA, ICC/IF
MAB6240
Species: Hu
Applications: WB, IHC
NB110-60521
Species: Hu
Applications: WB, Flow
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-02164
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00006045-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-53380
Species: Hu
Applications: ICC/IF, IHC-P, PAGE
NB100-56346
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
AF6008
Species: Hu, Mu, Rt
Applications: WB
H00003930-B01P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-88856
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for HSD17B8 Antibody (NBP1-84309) (0)

There are no publications for HSD17B8 Antibody (NBP1-84309).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HSD17B8 Antibody (NBP1-84309) (0)

There are no reviews for HSD17B8 Antibody (NBP1-84309). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HSD17B8 Antibody (NBP1-84309) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HSD17B8 Products

Bioinformatics Tool for HSD17B8 Antibody (NBP1-84309)

Discover related pathways, diseases and genes to HSD17B8 Antibody (NBP1-84309). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HSD17B8 Antibody (NBP1-84309)

Discover more about diseases related to HSD17B8 Antibody (NBP1-84309).
 

Pathways for HSD17B8 Antibody (NBP1-84309)

View related products by pathway.

Blogs on HSD17B8

There are no specific blogs for HSD17B8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HSD17B8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HSD17B8