HSD17B8 Antibody - BSA Free

Immunohistochemistry-Paraffin: HSD17B8 Antibody [NBP1-84309] - Staining in human parathyroid gland and testis tissues using anti-HSD17B8 antibody. Corresponding HSD17B8 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: HSD17B8 Antibody [NBP1-84309] - Staining of human parathyroid gland shows high expression.

Immunohistochemistry-Paraffin: HSD17B8 Antibody [NBP1-84309] - Staining of human testis shows low expression as expected.

Analysis in control (vector only transfected HEK293T lysate) and HSD17B8 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY415425).

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

HSD17B8 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit HSD17B8 Antibody - BSA Free (NBP1-84309) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKVPQKVVDKITEMIPMGHLGDPEDVADVVAFLASEDSGY
• Predicted Species: Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HSD17B8
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  HSD17B8 Protein (NBP1-84309PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for HSD17B8 Antibody - BSA Free

• D6S2245EdJ1033B10.9
• EC 1.1.1.-
• EC 1.1.1.62
• EC 1.1.1.63,17-beta-HSD 8
• estrogen 17-oxidoreductase
• FABGLestradiol 17-beta-dehydrogenase 8
• H2-KE6
• HKE6FabG (beta-ketoacyl-[acyl-carrier-protein] reductase, E coli) like (E. coli)
• hydroxysteroid (17-beta) dehydrogenase 8,3-oxoacyl-[acyl-carrier-protein] reductase
• KE6
• ke-6
• Ke-6,17-beta-hydroxysteroid dehydrogenase 8
• Protein Ke6
• Really interesting new gene 2 protein
• RING2FABG
• SDR30C1
• short chain dehydrogenase/reductase family 30C, member 1
• Testosterone 17-beta-dehydrogenase 8

Background

In mice, the Ke6 protein is a 17-beta-hydroxysteroid dehydrogenase that can regulate the concentration of biologically active estrogens and androgens. It is preferentially an oxidative enzyme and inactivates estradiol, testosterone, and dihydrotestosterone. However, the enzyme has some reductive activity and can synthesize estradiol from estrone. The protein encoded by this gene is similar to Ke6 and is a member of the short-chain dehydrogenase superfamily. An alternatively spliced transcript of this gene has been detected, but the full-length nature of this variant has not been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HSD17B8