Tapasin Antibody

Images

 
Immunohistochemistry: Tapasin Antibody [NBP1-86968] - Staining of human stomach shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Tapasin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QEGTYLATIHLPYLQGQVTLELAVYKPPKVSLMPATLARAAPGEAPPELLCLVSHFYPSGGLEVEWELRGGPGGRSQKAEGQRWLSALRHHSDGSVSLSGHLQPPPVTTEQHGARYACRIHHPS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TAPBP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in Immunohistochemistry-Paraffin reported in scientific literature (PMID 26310568)
Control Peptide
Tapasin Protein (NBP1-86968PEP)
Publications
Read Publication using
NBP1-86968 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Tapasin Antibody

  • NGS17
  • NGS-17
  • TAP binding protein (tapasin)
  • tapasin
  • TAPATAP-associated protein
  • TPN
  • TPSNTAP-binding protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01346
Species: Hu, Mu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-54435
Species: Hu
Applications: WB, Flow, IP
NBP1-31649
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90286
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38401
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
NBP1-84796
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89312
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-31769
Species: Hu
Applications: IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-1965
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Dr, GP, Rb, Sh, Xp, Ze
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-29931
Species: Hu
Applications: WB, Flow, IHC-P
NBP2-01817
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-85740
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP2-37570
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC

Publications for Tapasin Antibody (NBP1-86968)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC-P.


Filter By Application
IHC-P
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for Tapasin Antibody (NBP1-86968) (0)

There are no reviews for Tapasin Antibody (NBP1-86968). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Tapasin Antibody (NBP1-86968) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Tapasin Products

Bioinformatics Tool for Tapasin Antibody (NBP1-86968)

Discover related pathways, diseases and genes to Tapasin Antibody (NBP1-86968). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Tapasin Antibody (NBP1-86968)

Discover more about diseases related to Tapasin Antibody (NBP1-86968).
 

Pathways for Tapasin Antibody (NBP1-86968)

View related products by pathway.

PTMs for Tapasin Antibody (NBP1-86968)

Learn more about PTMs related to Tapasin Antibody (NBP1-86968).

Blogs on Tapasin

There are no specific blogs for Tapasin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Tapasin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TAPBP
Entrez
Uniprot