RUNX1T1/ETO Antibody


Western Blot: RUNX1T1/ETO Antibody [NBP2-55747] - H2135 and H2087 non-small cell lung cancer cells showing baseline Runx1T1 expression versus Runx1T1 stable overexpression. Image submitted by a verified customer review. more
Immunocytochemistry/ Immunofluorescence: RUNX1T1/ETO Antibody [NBP2-55747] - Staining of human cell line HEK 293 shows localization to nucleoplasm. Antibody staining is shown in green.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF

Order Details

RUNX1T1/ETO Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KGGGSSSSHSRQQSPVNPDPVALDAHREFLHRPASGYVPEEIWKKAE
Specificity of human RUNX1T1/ETO antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (96%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. RUNX1T1/ETO antibody validated for WB from a verified customer review.
Control Peptide
RUNX1T1/ETO Recombinant Protein Antigen (NBP2-55747PEP)
Reviewed Applications
Read 1 Review rated 5
NBP2-55747 in the following applications:

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for RUNX1T1/ETO Antibody

  • AML1T1protein CBFA2T1
  • CBFA2T1Cyclin-D-related protein
  • CDRMGC2796
  • core-binding factor, runt domain, alpha subunit 2; translocated to, 1; cyclinD-related
  • DKFZp564B213
  • Eight twenty one protein
  • ETOFLJ33145
  • MTG8acute myelogenous leukemia 1 translocation 1, cyclin-D related
  • Protein ETO
  • Protein MTG8
  • runt-related transcription factor 1; translocated to, 1 (cyclin D-related)
  • Zinc finger MYND domain-containing protein 2
  • ZMYND2myeloid translocation gene on 8q22


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Ch
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu(-)
Applications: WB, ELISA, IHC, IHC-P, IP
Species: Hu
Applications: ICC/IF
Species: Hu, Mu
Applications: WB, ChIP, IP, CHIP-SEQ
Species: Hu
Applications: WB, Simple Western
Species: Hu, Mu
Applications: WB, Flow, IB, ICC/IF, IHC, IHC-P, IP, PLA, KD
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Bv(-), Ca(-), Eq(-), Gp(-), Mu(-), Po(-)
Applications: WB, ELISA, ICC/IF, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, ICC/IF

Publications for RUNX1T1/ETO Antibody (NBP2-55747) (0)

There are no publications for RUNX1T1/ETO Antibody (NBP2-55747).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for RUNX1T1/ETO Antibody (NBP2-55747) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP2-55747:
Filter by Applications
All Applications
Filter by Species
All Species
Images Ratings Applications Species Date Details
Western Blot RUNX1T1/ETO NBP2-55747
reviewed by:
Karen McColl
WB Human 02/07/2018


ApplicationWestern Blot
Sample TestedNon-small cell lung cancer


CommentsTransferred in Caps Buffer for 2 hrs at 250mA. Used a 1:3000 primary antibody dilution and a 1:10,000 anti-rabbit secondary. Signal is very strong with a regular ECL solution.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RUNX1T1/ETO Antibody (NBP2-55747) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional RUNX1T1/ETO Products

Bioinformatics Tool for RUNX1T1/ETO Antibody (NBP2-55747)

Discover related pathways, diseases and genes to RUNX1T1/ETO Antibody (NBP2-55747). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RUNX1T1/ETO Antibody (NBP2-55747)

Discover more about diseases related to RUNX1T1/ETO Antibody (NBP2-55747).

Pathways for RUNX1T1/ETO Antibody (NBP2-55747)

View related products by pathway.

PTMs for RUNX1T1/ETO Antibody (NBP2-55747)

Learn more about PTMs related to RUNX1T1/ETO Antibody (NBP2-55747).

Blogs on RUNX1T1/ETO

There are no specific blogs for RUNX1T1/ETO, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Recent Reviews


Karen McColl
Application: WB
Species: Human


Gene Symbol RUNX1T1