RUNX1T1/ETO Antibody

Images

 
Western Blot: RUNX1T1/ETO Antibody [NBP2-55747] - H2135 and H2087 non-small cell lung cancer cells showing baseline Runx1T1 expression versus Runx1T1 stable overexpression. Image submitted by a verified customer review. ...read more
Immunocytochemistry/ Immunofluorescence: RUNX1T1/ETO Antibody [NBP2-55747] - Staining of human cell line HEK 293 shows localization to nucleoplasm. Antibody staining is shown in green.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RUNX1T1/ETO Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KGGGSSSSHSRQQSPVNPDPVALDAHREFLHRPASGYVPEEIWKKAE
Predicted Species
Mouse (98%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RUNX1T1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. RUNX1T1/ETO antibody validated for WB from a verified customer review.
Control Peptide
RUNX1T1/ETO Recombinant Protein Antigen (NBP2-55747PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP2-55747 in the following applications:

Publications
Read Publication using
NBP2-55747 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for RUNX1T1/ETO Antibody

  • AML1T1protein CBFA2T1
  • CBFA2T1Cyclin-D-related protein
  • CDRMGC2796
  • core-binding factor, runt domain, alpha subunit 2; translocated to, 1; cyclinD-related
  • DKFZp564B213
  • Eight twenty one protein
  • ETOFLJ33145
  • MTG8acute myelogenous leukemia 1 translocation 1, cyclin-D related
  • Protein ETO
  • Protein MTG8
  • runt-related transcription factor 1; translocated to, 1 (cyclin D-related)
  • Zinc finger MYND domain-containing protein 2
  • ZMYND2myeloid translocation gene on 8q22

Background

RUNX1T1 / ETO is encoded by this gene is a putative zinc finger transcription factor and oncoprotein. In acute myeloid leukemia, especially in the M2 subtype, the t(8;21)(q22;q22) translocation is one of the most frequent karyotypic abnormalities. The translocation produces a chimeric gene made up of the 5'-region of the RUNX1 gene fused to the 3'-region of this gene. The chimeric protein is thought to associate with the nuclear corepressor/histone deacetylase complex to block hematopoietic differentiation. Several transcript variants encoding multiple isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89105
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-86613
Species: Hu
Applications: IHC, IHC-P, WB
NB7276
Species: Ch
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NB110-58345
Species: Bv, Hu, Mu, Pm
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-57758
Species: Hu
Applications: ICC/IF
NB100-58824
Species: Hu, Mu
Applications: CHIP-SEQ, ChIP, IP, WB
AF5414
Species: Hu
Applications: Simple Western, WB
NB100-59787
Species: Hu, Mu
Applications: Flow, IB, ICC/IF, IHC, IHC-P, IP, KD, PLA, WB
NBP2-57636
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-49409
Species: Hu
Applications: IHC, IHC-P
NBP1-83435
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-66967
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF5129
Species: Hu
Applications: WB
NBP1-81555
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP2-34136
Species: Hu
Applications: IHC, IHC-P, WB
NB600-1071
Species: Hu(-), Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-52406
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
7954-GM/CF
Species: Hu
Applications: BA
NBP2-55747
Species: Hu, Mu, Rt
Applications: WB, ICC/IF

Publications for RUNX1T1/ETO Antibody (NBP2-55747)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species
Showing Publication 1 - 1 of 1.
Publication using NBP2-55747 Applications Species
He T Identification and clinical significance of two divergent regulators in thoracic malignancy: miR-18a and RUNX1T1 Thesis Jan 1 2021 (WB, Human) WB Human

Review for RUNX1T1/ETO Antibody (NBP2-55747) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP2-55747:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot RUNX1T1/ETO NBP2-55747
Enlarge
5
reviewed by:
Verified Customer
WB Human 02/07/2018
View

Summary

ApplicationWestern Blot
Sample TestedNon-small cell lung cancer
SpeciesHuman
LotR59770

Comments

CommentsTransferred in Caps Buffer for 2 hrs at 250mA. Used a 1:3000 primary antibody dilution and a 1:10,000 anti-rabbit secondary. Signal is very strong with a regular ECL solution.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RUNX1T1/ETO Antibody (NBP2-55747) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RUNX1T1/ETO Products

Bioinformatics Tool for RUNX1T1/ETO Antibody (NBP2-55747)

Discover related pathways, diseases and genes to RUNX1T1/ETO Antibody (NBP2-55747). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RUNX1T1/ETO Antibody (NBP2-55747)

Discover more about diseases related to RUNX1T1/ETO Antibody (NBP2-55747).
 

Pathways for RUNX1T1/ETO Antibody (NBP2-55747)

View related products by pathway.

PTMs for RUNX1T1/ETO Antibody (NBP2-55747)

Learn more about PTMs related to RUNX1T1/ETO Antibody (NBP2-55747).

Blogs on RUNX1T1/ETO

There are no specific blogs for RUNX1T1/ETO, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Verified Customer
02/07/2018
Application: WB
Species: Human

Bioinformatics

Gene Symbol RUNX1T1