RUNX1T1/ETO Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: RUNX1T1/ETO Antibody [NBP2-55747] - Staining of human cell line HEK 293 shows localization to nucleoplasm.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RUNX1T1/ETO Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KGGGSSSSHSRQQSPVNPDPVALDAHREFLHRPASGYVPEEIWKKAE
Specificity
Specificity of human RUNX1T1/ETO antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RUNX1T1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RUNX1T1/ETO Recombinant Protein Antigen (NBP2-55747PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP2-55747 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for RUNX1T1/ETO Antibody

  • AML1T1protein CBFA2T1
  • CBFA2T1Cyclin-D-related protein
  • CDRMGC2796
  • core-binding factor, runt domain, alpha subunit 2; translocated to, 1; cyclinD-related
  • DKFZp564B213
  • Eight twenty one protein
  • ETOFLJ33145
  • MTG8acute myelogenous leukemia 1 translocation 1, cyclin-D related
  • Protein ETO
  • Protein MTG8
  • runt-related transcription factor 1; translocated to, 1 (cyclin D-related)
  • Zinc finger MYND domain-containing protein 2
  • ZMYND2myeloid translocation gene on 8q22

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89105
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86613
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-34252
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP2-10509
Species: Hu, Mu(-)
Applications: WB, ELISA, IHC, IHC-P, IP
NBP2-57758
Species: Hu
Applications: ICC/IF
NB100-58824
Species: Hu, Mu
Applications: WB, ChIP, IP, CHIP-SEQ
AF5414
Species: Hu
Applications: WB, Simple Western
NB100-59787
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-57636
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-90226
Species: Hu
Applications: IHC, IHC-P
NBP1-83435
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87025
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-19097
Species: Hu
Applications: Flow, ICC/IF, IP
NBP1-80073
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-34136
Species: Hu
Applications: WB, IHC, IHC-P
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-52406
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-55747
Species: Hu, Mu, Rt
Applications: WB, ICC/IF

Publications for RUNX1T1/ETO Antibody (NBP2-55747) (0)

There are no publications for RUNX1T1/ETO Antibody (NBP2-55747).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for RUNX1T1/ETO Antibody (NBP2-55747) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP2-55747:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot RUNX1T1/ETO NBP2-55747
Enlarge
reviewed by:
Karen McColl
WB Human 02/07/2018
View

Summary

ApplicationWestern Blot
Sample TestedNon-small cell lung cancer
SpeciesHuman
LotR59770

Comments

CommentsTransferred in Caps Buffer for 2 hrs at 250mA. Used a 1:3000 primary antibody dilution and a 1:10,000 anti-rabbit secondary. Signal is very strong with a regular ECL solution.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RUNX1T1/ETO Antibody (NBP2-55747) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for RUNX1T1/ETO Antibody (NBP2-55747)

Discover related pathways, diseases and genes to RUNX1T1/ETO Antibody (NBP2-55747). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RUNX1T1/ETO Antibody (NBP2-55747)

Discover more about diseases related to RUNX1T1/ETO Antibody (NBP2-55747).
 

Pathways for RUNX1T1/ETO Antibody (NBP2-55747)

View related products by pathway.

PTMs for RUNX1T1/ETO Antibody (NBP2-55747)

Learn more about PTMs related to RUNX1T1/ETO Antibody (NBP2-55747).

Blogs on RUNX1T1/ETO

There are no specific blogs for RUNX1T1/ETO, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Karen McColl
02/07/2018
Application: WB
Species: Human

Bioinformatics

Gene Symbol RUNX1T1