Home » RUNX1T1/ETO » RUNX1T1/ETO Antibodies » RUNX1T1/ETO Antibody

RUNX1T1/ETO Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: RUNX1T1/ETO Antibody [NBP2-55747] - Staining of human cell line HEK 293 shows localization to nucleoplasm.
Immunocytochemistry/ Immunofluorescence: RUNX1T1/ETO Antibody [NBP2-55747] - Staining of human cell line HEK 293 shows localization to nucleoplasm.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

RUNX1T1/ETO Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KGGGSSSSHSRQQSPVNPDPVALDAHREFLHRPASGYVPEEIWKKAE
Specificity
Specificity of human RUNX1T1/ETO antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RUNX1T1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RUNX1T1/ETO Recombinant Protein Antigen (NBP2-55747PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for RUNX1T1/ETO Antibody

  • AML1T1protein CBFA2T1
  • CBFA2T1Cyclin-D-related protein
  • CDRMGC2796
  • core-binding factor, runt domain, alpha subunit 2; translocated to, 1; cyclinD-related
  • DKFZp564B213
  • Eight twenty one protein
  • ETOFLJ33145
  • MTG8acute myelogenous leukemia 1 translocation 1, cyclin-D related
  • Protein ETO
  • Protein MTG8
  • runt-related transcription factor 1; translocated to, 1 (cyclin D-related)
  • Zinc finger MYND domain-containing protein 2
  • ZMYND2myeloid translocation gene on 8q22

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

RUNX1/CBFA2
Antibody
NBP1-89105
Western Blot: RUNX1/CBFA2 Antibody [NBP1-89105] - Analysis in control (vector only transfected HEK293T lysate) and rUNX1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/Immunofluorescence: RUNX1/CBFA2 Antibody [NBP1-89105] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & vesicles.
Immunohistochemistry-Paraffin: RUNX1/CBFA2 Antibody [NBP1-89105] - Staining in human bone marrow and skeletal muscle tissues using anti-RUNX1 antibody. Corresponding RUNX1 RNA-seq data are presented for the same tissues.
(1 Publication)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
SLC7A4 Antibody
NBP1-86613
Western Blot: SLC7A4 Antibody [NBP1-86613] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: SLC7A4 Antibody [NBP1-86613] - Staining in human testis and endometrium tissues using anti-SLC7A4 antibody. Corresponding SLC7A4 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: SLC7A4 Antibody [NBP1-86613] - Staining of human endometrium shows low expression as expected.
Species: Hu
Applications: WB, IHC, IHC-P
Mouse IgM Antibody
(II/41)
NBP1-43303
Flow Cytometry: Mouse IgM Antibody (II/41) [NBP1-43303] - Analysis of PE/Cy7 conjugate of NBP1-43303. Staining of C57BL/6 bone marrow cells with Anti-Human/Mouse CD45R (B220) FITC and 0.06 micrograms of Rat IgG2a ? Isotype Control PE-Cy7 (left) or 0.06 micrograms of Anti-Mouse IgM PE-Cy7 (right). Cells in the ly
Flow Cytometry: Mouse IgM Antibody (II/41) [NBP1-43303] - Staining of C57BL/6 splenocytes with 0.5 ug of Rat IgG2a kappa Isotype Control Purified (open histogram) or 0.5 ug of Anti-Mouse IgM Purified (filled histogram) followed by Anti-Rat IgG Biotin and Streptavidin PE. Total viable cells were used for analysis.
Flow Cytometry: Mouse IgM Antibody (II/41) [NBP1-43303] - Analysis of Allophycocyanin conjugate of NBP1-43303. Staining of C57Bl/6 bone marrow cells with Anti-Human/Mouse CD45R (B220) FITC and 0.125 ug of Rat IgG2a K Isotype Control APC (left) or 0.125 ug of Anti-Mouse IgM APC (right). Cells in the small scatter
Species: Mu
Applications: ELISA, Flow, IHC, IHC-Fr
CDR2 Antibody (33)
NBP2-10509
Western Blot: CDR2 Antibody (33) [NBP2-10509] - Western blot analysis of CDR2 expression in 1) HeLa control cell lysate and 2) HeLa cell lysate overexpressing CDR2.
Immunohistochemistry: CDR2 Antibody (33) [NBP2-10509] - IHC staining of CDR2 in human breast cancer using DAB with hematoxylin counterstain.
Western Blot: CDR2 Antibody (33) [NBP2-10509] - Western blot analysis of CDR2 expression in 1) HeLa, 2) NTERA-2 and 3) HepG2 whole cell lysates.
(1 Publication)
Species: Hu, Mu(-)
Applications: WB, ELISA, IHC, IHC-P, IP
CDR1 Antibody
NBP2-57758
Immunocytochemistry/Immunofluorescence: CDR1 Antibody [NBP2-57758] - Staining of human cell line BJ shows localization to nucleoplasm, the Golgi apparatus & centrosome.
Species: Hu
Applications: ICC/IF
NCOR1 Antibody
NB100-58824
Western Blot: NCOR1 Antibody [NB100-58824] - Detection of Human and Mouse NCoR by Western Blot. Samples: Whole cell lysate (5, 15 and 50 ug) from HeLa and (50 ug) from mouse NIH3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-NCoR antibody NB100-58824 used for WB at 0.04 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
Western Blot: NCOR1 Antibody [NB100-58824] - Detection of Human NCOR on HeLa whole cell lysate using NB100-5882. NCOR was also immunoprecipitated by rabbit anti-NCOR antibody NB100-58825.
(3 Publications)
Species: Hu, Mu
Applications: WB, ChIP, IP, CHIP-SEQ
c-Abl Antibody
[Unconjugated]
AF5414
Western blot shows lysates of Jurkat human acute T cell leukemia cell line, MCF‑7 human breast cancer cell line, and MDA‑MB‑453 human breast cancer cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human c-Abl Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5414) followed by HRP-conjugated Anti‑Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for c-Abl at approximately 135 - 145 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of Jurkat human acute T cell leukemia cell line, loaded at 0.2 mg/mL. A specific band was detected for c‑Abl at approximately 149 kDa (as indicated) using 10 µg/mL of Goat Anti-Human c‑Abl Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5414) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
(1 Publication)
Species: Hu
Applications: WB, Simple Western
PML Protein
Antibody
NB100-59787
Western Blot: PML Protein Antibody [NB100-59787] - Detection of Human PML on HeLa whole cell lysate using NB100-59787. PML was also immunoprecipitated by rabbit anti-PML antibodies NB100-59788 and another CDC16/APC6 Ab.
Immunohistochemistry-Paraffin: PML Protein Antibody [NB100-59787] - IHC analysis of a formalin fixed and paraffin embedded tissue section of human stomach using 1:50 dilution of PML antibody. The signal was developed using HRP-labeled secondary with DAB reagent followed by hematoxylin counterstaining. This antibody generated an expected strong nuclear staining in most of the cells in the glandular as well as the connective tissue. The cells showed some cytoplasmic signal also which was much weaker than the nuclear staining.
Immunohistochemistry-Paraffin: PML Protein Antibody [NB100-59787] - FFPE section of human breast carcinoma. Affinity purified rabbit anti-PML used at a dilution of 1:500
(22 Publications)
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP, PLA
CBFA2T3 Antibody
NBP2-57636
Western Blot: CBFA2T3 Antibody [NBP2-57636] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunohistochemistry-Paraffin: CBFA2T3 Antibody [NBP2-57636] - Immunohistochemical staining of human tonsil shows strong nuclear positivity in germinal and non-germinal center cells.
Species: Hu
Applications: WB, IHC, IHC-P
Band 3 Antibody
NBP1-90226
Immunohistochemistry-Paraffin: Band 3 Antibody [NBP1-90226] - Staining of human cerebral cortex shows low expression as expected.
Immunohistochemistry: Band 3 Antibody [NBP1-90226] - Staining of human colon shows distinct positivity in erythrocytes.
Immunohistochemistry-Paraffin: Band 3 Antibody [NBP1-90226] - Staining of human bone marrow shows high expression.
Species: Hu
Applications: IHC, IHC-P
Biliverdin
Reductase B/BLVRB Ant
NBP1-83435
Western Blot: Biliverdin Reductase B/BLVRB Antibody [NBP1-83435] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/Immunofluorescence: Biliverdin Reductase B/BLVRB Antibody [NBP1-83435] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Biliverdin Reductase B/BLVRB Antibody [NBP1-83435] - Staining of human spleen shows strong cytoplasmic positivity in subsets of cells in red and white pulp.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Myosin heavy chain
11 Antibody
NBP1-87025
Western Blot: Myosin heavy chain 11 Antibody [NBP1-87025] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Esophagus tissue
Immunocytochemistry/Immunofluorescence: Myosin heavy chain 11 Antibody [NBP1-87025] - Staining of human cell line U-2 OS shows positivity in nucleus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Myosin heavy chain 11 Antibody [NBP1-87025] - Staining in human prostate and skeletal muscle tissues using anti-MYH11 antibody. Corresponding MYH11 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
BCR Antibody
AF5129
Western blot shows lysates of HepG2 human hepatocellular carcinoma cell line, K562 human chronic myelogenous leukemia cell line, and MCF‑7 human breast cancer cell line. PVDF membrane was probed with 1 µg/mL of Human BCR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5129) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for BCR at approximately 155 - 165 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Publication)
Species: Hu
Applications: WB
MLC1 Antibody
NBP1-80073
Western Blot: MLC1 Antibody [NBP1-80073] - Titration: 0.2-1 ug/ml, Positive Control: Human Spleen.
Immunohistochemistry-Paraffin: MLC1 Antibody [NBP1-80073] - Rat Astrocytes, 20 ug/ml.
Western Blot: MLC1 Antibody [NBP1-80073] - Human Fetal Spleen, Antibody Dilution: 1.0 ug/ml.
Species: Hu, Rt
Applications: WB, IHC, IHC-P
CD4 Antibody
NBP1-19371
Western Blot: CD4 Antibody [NBP1-19371] - CD4 antibody was tested in the following cell lysates: Lane 1) human spleen 2) human tonsil 3) human placenta 4) human kidney 5) human liver 6) mouse spleen 7) mouse placenta 8) rat placenta.
Immunocytochemistry/Immunofluorescence: CD4 Antibody [NBP1-19371] - CD4 antibody was tested in Jurkat cells with Dylight 488 (green). Nuclei were counterstained with DAPI (blue).
Immunohistochemistry-Frozen: CD4 Antibody [NBP1-19371] - Staining in mouse liver tissue.
(13 Publications)
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
MTGR1 Antibody
NBP2-34136
Western Blot: MTGR1 Antibody [NBP2-34136] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: MTGR1 Antibody [NBP2-34136] - Staining in human testis and liver tissues using anti-CBFA2T2 antibody. Corresponding CBFA2T2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: MTGR1 Antibody [NBP2-34136] - Staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.
Species: Hu
Applications: WB, IHC, IHC-P
CD34 Antibody (MEC
14.7)
NB600-1071
Immunocytochemistry/Immunofluorescence: CD34 Antibody (MEC 14.7) [NB600-1071] - CD34 antibody was tested in WEHI-3 cells with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).
Immunohistochemistry-Paraffin: CD34 Antibody (MEC 14.7) [NB600-1071] - IHC analysis of a formalin fixed and paraffin embedded tissue section of mouse small intestine using rat anti-mouse CD34 (clone MEC 14.7) at 1:100 dilution. The signal was developed using HRP-conjugated anti-rat secondary with DAB reagent which followed counterstaining of nuclei using hematoxylin. This antibody specifically labelled the endothelial cells in blood vessels located primarily in the sub-mucosa, and of that of the mucosa muscularis and the mucosal lacteal.
Flow Cytometry: CD34 Antibody (MEC 14.7) [NB600-1071] - CD34 (MEC 14.7) antibody was tested at 1:250 in WEHI-3 cells with DyLight 488 (green) alongside a matched isotype control (black).
(17 Publications)
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
FANCB Antibody
(M38P3E10)
NBP2-52406
Immunohistochemistry-Paraffin: FANCB Antibody (M38P3E10) [NBP2-52406] - Staining was performed on formalin-fixed, paraffin-embedded human breast cancer tissue sections using anti-FANCB [M38P3E10]. The antibody shows both nuclear and cytoplasmic staining but it is predominately cytoplasmic.
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
GM-CSF
[Unconjugated]
215-GM/CF
1 μg/lane of Recombinant Human GM-CSF was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 14 kDa.
Recombinant Human GM-CSF (Catalog # 215-IL/CF) stimulates cell proliferation of the TF-1 human erythroleukemic cell line. The ED50 for this effect is 6-30 pg/mL.
(211 Publications)
Species: Hu
RUNX1T1/ETO
Antibody
NBP2-55747
RUNX1T1/ETO Antibody
Species: Hu, Mu, Rt
Applications: WB, ICC/IF

Publications for RUNX1T1/ETO Antibody (NBP2-55747) (0)

There are no publications for RUNX1T1/ETO Antibody (NBP2-55747).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RUNX1T1/ETO Antibody (NBP2-55747) (0)

There are no reviews for RUNX1T1/ETO Antibody (NBP2-55747). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RUNX1T1/ETO Antibody (NBP2-55747) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for RUNX1T1/ETO Antibody (NBP2-55747)

Discover related pathways, diseases and genes to RUNX1T1/ETO Antibody (NBP2-55747). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RUNX1T1/ETO Antibody (NBP2-55747)

Discover more about diseases related to RUNX1T1/ETO Antibody (NBP2-55747).
 

Pathways for RUNX1T1/ETO Antibody (NBP2-55747)

View related products by pathway.

PTMs for RUNX1T1/ETO Antibody (NBP2-55747)

Learn more about PTMs related to RUNX1T1/ETO Antibody (NBP2-55747).

Blogs on RUNX1T1/ETO

There are no specific blogs for RUNX1T1/ETO, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RUNX1T1/ETO Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol RUNX1T1