![Immunocytochemistry/Immunofluorescence: RUNX1T1/ETO Antibody [NBP2-55747] - Staining of human cell line HEK 293 shows localization to nucleoplasm. Antibody staining is shown in green.](http://images.novusbio.com/fullsize2/RUNX1T1-ETO Antibody-Immunocytochemistry-Immunofluorescence-NBP2-55747-img0001.jpg "Immunocytochemistry/Immunofluorescence: RUNX1T1/ETO Antibody [NBP2-55747] - Staining of human cell line HEK 293 shows localization to nucleoplasm. Antibody staining is shown in green.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KGGGSSSSHSRQQSPVNPDPVALDAHREFLHRPASGYVPEEIWKKAE |
| Specificity | Specificity of human RUNX1T1/ETO antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Predicted Species | Mouse (98%), Rat (96%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RUNX1T1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. WB reactivity per customer review. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
| Images | Ratings | Applications | Species | Date | Details | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Karen McColl |
WB | Human | 02/07/2018 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
Diseases for RUNX1T1/ETO Antibody (NBP2-55747)Discover more about diseases related to RUNX1T1/ETO Antibody (NBP2-55747).
| Pathways for RUNX1T1/ETO Antibody (NBP2-55747)View related products by pathway.
|
PTMs for RUNX1T1/ETO Antibody (NBP2-55747)Learn more about PTMs related to RUNX1T1/ETO Antibody (NBP2-55747).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | RUNX1T1 |
![Immunocytochemistry/Immunofluorescence: RUNX1/CBFA2 Antibody [NBP1-89105] - Staining human cell line A-431 shows localization to nucleoplasm & vesicles. Antibody staining is shown in green.](http://images.novusbio.com/fullsize2/RUNX1-CBFA2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89105-img0008.jpg)
![Immunohistochemistry-Paraffin: RUNX1/CBFA2 Antibody [NBP1-89105] - Staining of human bone marrow shows high expression.](http://images.novusbio.com/fullsize2/RUNX1-CBFA2-Antibody-Immunohistochemistry-Paraffin-NBP1-89105-img0012.jpg)
![Immunohistochemistry-Paraffin: RUNX1/CBFA2 Antibody [NBP1-89105] - Staining of human skeletal muscle shows low expression as expected.](http://images.novusbio.com/fullsize2/RUNX1-CBFA2-Antibody-Immunohistochemistry-Paraffin-NBP1-89105-img0010.jpg)
![Western Blot: SLC7A4 Antibody [NBP1-86613] - Analysis in control (vector only transfected HEK293T lysate) and SLC7A4 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize2/SLC7A4 Antibody-Western Blot-NBP1-86613-img0010.jpg)
![Immunohistochemistry-Paraffin: SLC7A4 Antibody [NBP1-86613] - Staining in human testis and endometrium tissues using anti-SLC7A4 antibody. Corresponding SLC7A4 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize2/SLC7A4-Antibody-Immunohistochemistry-Paraffin-NBP1-86613-img0009.jpg)
![Immunohistochemistry-Paraffin: SLC7A4 Antibody [NBP1-86613] - Staining of human endometrium shows low expression as expected.](http://images.novusbio.com/fullsize2/SLC7A4-Antibody-Immunohistochemistry-Paraffin-NBP1-86613-img0007.jpg)
![Immunohistochemistry-Paraffin: IgM Antibody (DA4-4) [NBP2-34252] - Formalin-fixed, paraffin-embedded human tonsil stained with IgM MAb (DA4-4)](http://images.novusbio.com/fullsize2/IgM Antibody (DA4-4)-Immunohistochemistry-Paraffin-NBP2-34252-img0001.jpg)
![Western Blot: CDR2 Antibody (33) [NBP2-10509] - Western blot analysis of CDR2 expression in 1) HeLa control cell lysate and 2) HeLa cell lysate overexpressing CDR2.](http://images.novusbio.com/fullsize/CDR2-Antibody-(33)-Western-Blot-NBP2-10509-img0003.jpg)
![Immunohistochemistry: CDR2 Antibody (33) [NBP2-10509] - IHC staining of CDR2 in human breast cancer using DAB with hematoxylin counterstain.](http://images.novusbio.com/fullsize2/CDR2-Antibody-(33)-Immunohistochemistry-NBP2-10509-img0004.jpg)
![Western Blot: CDR2 Antibody (33) [NBP2-10509] - Western blot analysis of CDR2 expression in 1) HeLa, 2) NTERA-2 and 3) HepG2 whole cell lysates.](http://images.novusbio.com/fullsize/CDR2-Antibody-(33)-Western-Blot-NBP2-10509-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: CDR1 Antibody [NBP2-57758] - Staining of human cell line BJ shows localization to nucleoplasm, the Golgi apparatus & centrosome. Antibody staining is shown in green.](http://images.novusbio.com/fullsize2/CDR1 Antibody-Immunocytochemistry-Immunofluorescence-NBP2-57758-img0001.jpg)
![Western Blot: NCOR1 Antibody [NB100-58824] - Detection of Human and Mouse NCoR by Western Blot. Samples: Whole cell lysate (5, 15 and 50 ug) from HeLa and (50 ug) from mouse NIH3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-NCoR antibody NB100-58824 used for WB at 0.04 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.](http://images.novusbio.com/fullsize2/NCOR1-Antibody-Western-Blot-NB100-58824-img0006.jpg)
![Western Blot: NCOR1 Antibody [NB100-58824] - Detection of Human NCOR on HeLa whole cell lysate using NB100-5882. NCOR was also immunoprecipitated by rabbit anti-NCOR antibody NB100-58825.](http://images.novusbio.com/fullsize2/NCOR1-Antibody-Western-Blot-NB100-58824-img0001.jpg)
![Western Blot: PML Protein Antibody [NB100-59787] - Detection of Human PML on HeLa whole cell lysate using NB100-59787. PML was also immunoprecipitated by rabbit anti-PML antibodies NB100-59788 and another CDC16/APC6 Ab.](http://images.novusbio.com/fullsize2/PML-Protein-Antibody-Western-Blot-NB100-59787-img0016.jpg)
![Immunohistochemistry-Paraffin: PML Protein Antibody [NB100-59787] - IHC analysis of a formalin fixed and paraffin embedded tissue section of human stomach using 1:50 dilution of PML antibody. The signal was developed using HRP-labeled secondary with DAB reagent followed by hematoxylin counterstaining. This antibody generated an expected strong nuclear staining in most of the cells in the glandular as well as the connective tissue. The cells showed some cytoplasmic signal also which was much weaker than the nuclear staining.](http://images.novusbio.com/fullsize2/PML-Protein-Antibody-Immunohistochemistry-Paraffin-NB100-59787-img0018.jpg)
![Immunohistochemistry-Paraffin: PML Protein Antibody [NB100-59787] - FFPE section of human breast carcinoma. Affinity purified rabbit anti-PML used at a dilution of 1:500](http://images.novusbio.com/fullsize2/PML-Protein-Antibody-Immunohistochemistry-Paraffin-NB100-59787-img0015.jpg)
![Western Blot: CBFA2T3 Antibody [NBP2-57636] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.](http://images.novusbio.com/fullsize2/CBFA2T3 Antibody-Western Blot-NBP2-57636-img0002.jpg)
![Immunohistochemistry-Paraffin: CBFA2T3 Antibody [NBP2-57636] - Immunohistochemical staining of human tonsil shows strong nuclear positivity in germinal and non-germinal center cells.](http://images.novusbio.com/fullsize2/CBFA2T3-Antibody-Immunohistochemistry-Paraffin-NBP2-57636-img0001.jpg)
![Western Blot: Biliverdin Reductase B/BLVRB Antibody [NBP1-83435] - Analysis using Anti-BLVRB antibody NBP1-83435 (A) shows similar pattern to independent antibody NBP1-83434 (B).](http://images.novusbio.com/fullsize2/Biliverdin-Reductase-B-BLVRB-Antibody-Western-Blot-NBP1-83435-img0014.jpg)
![Immunocytochemistry/Immunofluorescence: Biliverdin Reductase B/BLVRB Antibody [NBP1-83435] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.](http://images.novusbio.com/fullsize2/Biliverdin-Reductase-B-BLVRB-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83435-img0007.jpg)
![Immunohistochemistry-Paraffin: Biliverdin Reductase B/BLVRB Antibody [NBP1-83435] - Staining of human colon shows moderate to strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize2/Biliverdin-Reductase-B-BLVRB-Antibody-Immunohistochemistry-Paraffin-NBP1-83435-img0018.jpg)
![Immunocytochemistry/Immunofluorescence: Myosin heavy chain 11 Antibody (JA03-35) [NBP2-66967] - Staining smooth muscle Myosin heavy chain 11 in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.](http://images.novusbio.com/fullsize2/Myosin-heavy-chain-11-Antibody-(JA03-35)-Immunocytochemistry-Immunofluorescence-NBP2-66967-img0002.jpg)
![Immunohistochemistry-Paraffin: Myosin heavy chain 11 Antibody (JA03-35) [NBP2-66967] - Analysis of paraffin-embedded human stomach cancer tissue using anti-smooth muscle Myosin heavy chain 11 antibody. Counter stained with hematoxylin.](http://images.novusbio.com/fullsize2/Myosin-heavy-chain-11-Antibody-(JA03-35)-Immunohistochemistry-Paraffin-NBP2-66967-img0006.jpg)
![Immunocytochemistry/Immunofluorescence: Myosin heavy chain 11 Antibody (JA03-35) [NBP2-66967] - Staining smooth muscle Myosin heavy chain 11 in 293T cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.](http://images.novusbio.com/fullsize2/Myosin-heavy-chain-11-Antibody-(JA03-35)-Immunocytochemistry-Immunofluorescence-NBP2-66967-img0001.jpg)
![Western Blot: MLC1 Antibody [NBP1-81555] - Analysis in control (vector only transfected HEK293T lysate) and MLC1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize2/MLC1-Antibody-Western-Blot-NBP1-81555-img0008.jpg)
![Immunohistochemistry-Paraffin: MLC1 Antibody [NBP1-81555] - Staining in human cerebral cortex and pancreas tissues using anti-MLC1 antibody. Corresponding MLC1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize2/MLC1-Antibody-Immunohistochemistry-Paraffin-NBP1-81555-img0007.jpg)
![Immunohistochemistry-Paraffin: MLC1 Antibody [NBP1-81555] - Staining of human cerebral cortex shows high expression.](http://images.novusbio.com/fullsize2/MLC1-Antibody-Immunohistochemistry-Paraffin-NBP1-81555-img0005.jpg)
![Western Blot: CD4 Antibody [NBP1-19371] - CD4 antibody was tested in the following cell lysates: 1) human spleen 2) human tonsil 3) human placenta 4) human kidney 5) human liver 6) mouse spleen 7) mouse placenta 8) rat placenta.](http://images.novusbio.com/fullsize2/CD4-Antibody-Western-Blot-NBP1-19371-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: CD4 Antibody [NBP1-19371] - CD4 antibody was tested in Jurkat cells with DyLight 488 (green). Nuclei were counterstained with DAPI (blue).](http://images.novusbio.com/fullsize2/CD4-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-19371-img0005.jpg)
![Immunohistochemistry-Frozen: CD4 Antibody [NBP1-19371] - Staining in mouse liver tissue.](http://images.novusbio.com/fullsize2/CD4-Antibody-Immunohistochemistry-Frozen-NBP1-19371-img0013.jpg)
![Western Blot: MTGR1 Antibody [NBP2-34136] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://images.novusbio.com/fullsize2/MTGR1-Antibody-Western-Blot-NBP2-34136-img0004.jpg)
![Immunohistochemistry-Paraffin: MTGR1 Antibody [NBP2-34136] - Staining in human testis and liver tissues using anti-CBFA2T2 antibody. Corresponding CBFA2T2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize2/MTGR1-Antibody-Immunohistochemistry-Paraffin-NBP2-34136-img0008.jpg)
![Immunohistochemistry-Paraffin: MTGR1 Antibody [NBP2-34136] - Staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.](http://images.novusbio.com/fullsize2/MTGR1-Antibody-Immunohistochemistry-Paraffin-NBP2-34136-img0005.jpg)
![Immunocytochemistry/Immunofluorescence: CD34 Antibody (MEC 14.7) [NB600-1071] - CD34 antibody was tested in WEHI-3 cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).](http://images.novusbio.com/fullsize2/CD34 Antibody (MEC 14.7)-Immunocytochemistry-Immunofluorescence-NB600-1071-img0003.jpg)
![Immunohistochemistry-Paraffin: CD34 Antibody (MEC 14.7) [NB600-1071] - Analysis of a FFPE tissue section of mouse small intestine using rat anti-mouse CD34 (clone MEC 14.7) at 1:100 dilution. The signal was developed using HRP-conjugated anti-rat secondary with DAB reagent which followed counterstaining of nuclei using hematoxylin. This antibody specifically labelled the endothelial cells in blood vessels located primarily in the sub-mucosa, and of that of the mucosa muscularis and the mucosal lacteal.](http://images.novusbio.com/fullsize2/CD34-Antibody-(MEC-14.7)-Immunohistochemistry-Paraffin-NB600-1071-img0014.jpg)
![Flow Cytometry: CD34 Antibody (MEC 14.7) [NB600-1071] - CD34 (MEC 14.7) antibody was tested at 1:250 in WEHI-3 cells with DyLight 488 (green) alongside a matched isotype control (black).](http://images.novusbio.com/fullsize2/CD34 Antibody (MEC 14.7)-Flow Cytometry-NB600-1071-img0002.jpg)
![Immunohistochemistry-Paraffin: FANCB Antibody (M38P3E10) [NBP2-52406] - Staining was performed on formalin-fixed, paraffin-embedded human breast cancer tissue sections using anti-FANCB [M38P3E10]. The antibody shows both nuclear and cytoplasmic staining but it is predominately cytoplasmic.](http://images.novusbio.com/fullsize2/FANCB-Antibody-(M38P3E10)-Immunohistochemistry-Paraffin-NBP2-52406-img0001.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.](http://images.novusbio.com/images2/Rabbit-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0006.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.")