Home » RUNX1T1/ETO » RUNX1T1/ETO Antibodies » RUNX1T1/ETO Antibody

RUNX1T1/ETO Antibody

 (1 Review)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: RUNX1T1/ETO Antibody [NBP2-55747] - H2135 and H2087 non-small cell lung cancer cells showing baseline Runx1T1 expression versus Runx1T1 stable overexpression. Image submitted by a verified customer review.
Western Blot: RUNX1T1/ETO Antibody [NBP2-55747] - H2135 and H2087 non-small cell lung cancer cells showing baseline Runx1T1 expression versus Runx1T1 stable overexpression. Image submitted by a verified customer review. ...read more
Immunocytochemistry/ Immunofluorescence: RUNX1T1/ETO Antibody [NBP2-55747] - Staining of human cell line HEK 293 shows localization to nucleoplasm. Antibody staining is shown in green.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

RUNX1T1/ETO Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KGGGSSSSHSRQQSPVNPDPVALDAHREFLHRPASGYVPEEIWKKAE
Specificity
Specificity of human RUNX1T1/ETO antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RUNX1T1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. RUNX1T1/ETO antibody validated for WB from a verified customer review.
Control Peptide
Reviewed Applications
Read 1 Review rated 5
using
NBP2-55747 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for RUNX1T1/ETO Antibody

  • AML1T1protein CBFA2T1
  • CBFA2T1Cyclin-D-related protein
  • CDRMGC2796
  • core-binding factor, runt domain, alpha subunit 2; translocated to, 1; cyclinD-related
  • DKFZp564B213
  • Eight twenty one protein
  • ETOFLJ33145
  • MTG8acute myelogenous leukemia 1 translocation 1, cyclin-D related
  • Protein ETO
  • Protein MTG8
  • runt-related transcription factor 1; translocated to, 1 (cyclin D-related)
  • Zinc finger MYND domain-containing protein 2
  • ZMYND2myeloid translocation gene on 8q22

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

RUNX1/CBFA2
Antibody (SD0803)
NBP2-67779
Western Blot: RUNX1/CBFA2 Antibody (SD0803) [NBP2-67779] - Analysis of RUNX1+RUNX2+RUNX3 on Jurkat cells lysates using anti-RUNX1+RUNX2+RUNX3 antibody at 1/1,000 dilution.
Immunocytochemistry/Immunofluorescence: RUNX1/CBFA2 Antibody (SD0803) [NBP2-67779] - Staining RUNX1+RUNX2+RUNX3 in N2A cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: RUNX1/CBFA2 Antibody (SD0803) [NBP2-67779] - Analysis of paraffin-embedded mouse testis tissue using anti-RUNX1+RUNX2+RUNX3 antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
SLC7A4 Antibody
NBP1-86613
Western Blot: SLC7A4 Antibody [NBP1-86613] - Analysis in control (vector only transfected HEK293T lysate) and SLC7A4 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: SLC7A4 Antibody [NBP1-86613] - Staining in human testis and endometrium tissues using anti-SLC7A4 antibody. Corresponding SLC7A4 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: SLC7A4 Antibody [NBP1-86613] - Staining of human endometrium shows low expression as expected.
Species: Hu
Applications: WB, IHC, IHC-P
Goat anti-Chicken
IgM Secondary Antibod ...
NB7276
Goat anti-Chicken IgM Secondary Antibody
(36 Publications)
Species: Ch
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
CDR2 Antibody
NB110-58345
Western Blot: CDR2 Antibody [NB110-58345] - Cdr2 expressed during mitosis, ubiquitinated and degraded during mitotic exit. Upper left, flow cytometry of G1/S- and G2/M-arrested HEK293s. Upper right, western blots of HEK293 G1/S and G2/M extracts probed with anti-cdr2 (NB110; top), cyclinB1 (middle) and gamma-tubulin (bottom). Bottom panel, cdr2 and cyclin B1 protein quantitation, normalized here and in D to gamma--tubulin levels; *p<0.001. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0010045), licensed under a CC-BY licence.
Immunohistochemistry: CDR2 Antibody [NB110-58345] - Purkinje neurons of the cerebellum.
Flow Cytometry: CDR2 Antibody [NB110-58345] - Analysis using the DyLight 488 conjugate of NB110-58345. Thymus epithelial cells CDR2. Image from verified customer review.
(1 Publication)
Species: Hu, Mu, Bv, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
CDR1 Antibody
NBP2-57758
Immunocytochemistry/Immunofluorescence: CDR1 Antibody [NBP2-57758] - Staining of human cell line BJ shows localization to nucleoplasm, the Golgi apparatus & centrosome. Antibody staining is shown in green.
Species: Hu
Applications: ICC/IF
NCOR1 Antibody
NB100-58824
Western Blot: NCOR1 Antibody [NB100-58824] - Whole cell lysate (50 ug) from HEK293T, K-562, and NIH 3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-NCoR antibodyused for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 3minutes.
Chromatin Immunoprecipitation Sequencing: NCOR1 Antibody [NB100-58824] - Localization of NCoR Binding Sites by ChIP-sequencing. Chromatin from K562 cells was immunoprecipitated with anti-NCoR antibody NB100-58824 and analyzed by DNA sequencing. The figure illustrates the peak distribution of NCoR binding within a 650 Kb region of the human X chromosome as detected using anti-NCoR antibody NB100-58824. ChIP-seq validation performed by Diogenode, Denville, NJ.
Immunoprecipitation: NCOR1 Antibody [NB100-58824] - Detection of Human NCOR on HeLa whole cell lysate using NB100-5882. NCOR was also immunoprecipitated by rabbit anti-NCOR antibody NB100-58825.
(3 Publications)
Species: Hu, Mu
Applications: WB, ChIP, IP, CHIP-SEQ
c-Abl Antibody
[Unconjugated]
AF5414
Western blot shows lysates of Jurkat human acute T cell leukemia cell line, MCF‑7 human breast cancer cell line, and MDA‑MB‑453 human breast cancer cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human c-Abl Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5414) followed by HRP-conjugated Anti‑Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for c-Abl at approximately 135 - 145 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of Jurkat human acute T cell leukemia cell line, loaded at 0.2 mg/mL. A specific band was detected for c‑Abl at approximately 149 kDa (as indicated) using 10 µg/mL of Goat Anti-Human c‑Abl Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5414) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
(2 Reviews)
(1 Publication)
Species: Hu
Applications: WB, Simple Western
PML Protein
Antibody
NB100-59787
Western Blot: PML Protein Antibody [NB100-59787] - Detection of Human PML on HeLa whole cell lysate using NB100-59787. PML was also immunoprecipitated by rabbit anti-PML antibodies NB100-59788 and another CDC16/APC6 Ab.
Immunohistochemistry-Paraffin: PML Protein Antibody [NB100-59787] - IHC analysis of a formalin fixed and paraffin embedded tissue section of human stomach using 1:50 dilution of PML antibody. The signal was developed using HRP-labeled secondary with DAB reagent followed by hematoxylin counterstaining. This antibody generated an expected strong nuclear staining in most of the cells in the glandular as well as the connective tissue. The cells showed some cytoplasmic signal also which was much weaker than the nuclear staining.
Immunohistochemistry-Paraffin: PML Protein Antibody [NB100-59787] - FFPE section of human breast carcinoma. Affinity purified rabbit anti-PML used at a dilution of 1:500
(1 Review)
(26 Publications)
Species: Hu, Mu
Applications: WB, Flow, IB, ICC/IF, IHC, IHC-P, IP, PLA, KD
CBFA2T3 Antibody
NBP2-57636
Western Blot: CBFA2T3 Antibody [NBP2-57636] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunohistochemistry-Paraffin: CBFA2T3 Antibody [NBP2-57636] - Immunohistochemical staining of human tonsil shows strong nuclear positivity in germinal and non-germinal center cells.
Species: Hu
Applications: WB, IHC, IHC-P
Band 3 Antibody
(BIII 136)
NB120-11012
Western Blot: Band 3 Antibody (BIII 136) [NB120-11012] - Human erythrocytes ghosts extract was separated on SDS-PAGE and probed with Monoclonal Anti-Band 3 Clone: BIII-136. The antibody was developed using Goat Anti-Mouse IgG-Peroxidase and AEC substrate.
Species: Hu, Bv(-), Ca(-), Eq(-), Gp(-), Mu(-), Po(-)
Applications: WB, ELISA, ICC/IF, IP
Biliverdin
Reductase B/BLVRB Ant
NBP1-83435
Western Blot: Biliverdin Reductase B/BLVRB Antibody [NBP1-83435] - Analysis using Anti-BLVRB antibody NBP1-83435 (A) shows similar pattern to independent antibody NBP1-83434 (B).
Immunocytochemistry/Immunofluorescence: Biliverdin Reductase B/BLVRB Antibody [NBP1-83435] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Biliverdin Reductase B/BLVRB Antibody [NBP1-83435] - Staining of human placenta shows moderate to strong cytoplasmic positivity in trophoblastic cells.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Myosin heavy chain
11 Antibody (JA03-35) ...
NBP2-66967
Immunocytochemistry/Immunofluorescence: Myosin heavy chain 11 Antibody (JA03-35) [NBP2-66967] - Staining smooth muscle Myosin heavy chain 11 in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: Myosin heavy chain 11 Antibody (JA03-35) [NBP2-66967] - Analysis of paraffin-embedded human stomach cancer tissue using anti-smooth muscle Myosin heavy chain 11 antibody. Counter stained with hematoxylin.
Immunocytochemistry/Immunofluorescence: Myosin heavy chain 11 Antibody (JA03-35) [NBP2-66967] - Staining smooth muscle Myosin heavy chain 11 in 293T cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
(1 Publication)
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
BCR Antibody
AF5129
Western blot shows lysates of HepG2 human hepatocellular carcinoma cell line, K562 human chronic myelogenous leukemia cell line, and MCF‑7 human breast cancer cell line. PVDF membrane was probed with 1 µg/mL of Human BCR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5129) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for BCR at approximately 155 - 165 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Publication)
Species: Hu
Applications: WB
MLC1 Antibody
NBP1-81555
Western Blot: MLC1 Antibody [NBP1-81555] - Analysis in control (vector only transfected HEK293T lysate) and MLC1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: MLC1 Antibody [NBP1-81555] - Staining in human cerebral cortex and pancreas tissues using anti-MLC1 antibody. Corresponding MLC1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: MLC1 Antibody [NBP1-81555] - Staining of human cerebral cortex shows high expression.
(1 Publication)
Species: Hu
Applications: WB, IHC, IHC-P
CD4 Antibody
NBP1-19371
Western Blot: CD4 Antibody [NBP1-19371] - CD4 antibody was tested in the following cell lysates: 1) human spleen 2) human tonsil 3) human placenta 4) human kidney 5) human liver 6) mouse spleen 7) mouse placenta 8) rat placenta.
Immunocytochemistry/Immunofluorescence: CD4 Antibody [NBP1-19371] - CD4 antibody was tested in Jurkat cells with DyLight 488 (green). Nuclei were counterstained with DAPI (blue).
Immunohistochemistry-Paraffin: CD4 Antibody [NBP1-19371] - Alcohol-fixed paraffin-embedded rat spleen tissue. Dilution 1:150. Image from verified customer review.
(8 Reviews)
(24 Publications)
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
MTGR1 Antibody
NBP2-34136
Western Blot: MTGR1 Antibody [NBP2-34136] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: MTGR1 Antibody [NBP2-34136] - Staining in human testis and liver tissues using anti-CBFA2T2 antibody. Corresponding CBFA2T2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: MTGR1 Antibody [NBP2-34136] - Staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.
Species: Hu
Applications: WB, IHC, IHC-P
CD34 Antibody (MEC
14.7)
NB600-1071
Immunocytochemistry/Immunofluorescence: CD34 Antibody (MEC 14.7) [NB600-1071] - CD34 antibody was tested in WEHI-3 cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).
Immunohistochemistry-Paraffin: CD34 Antibody (MEC 14.7) [NB600-1071] - Analysis of a FFPE tissue section of mouse small intestine using rat anti-mouse CD34 (clone MEC 14.7) at 1:100 dilution. The signal was developed using HRP-conjugated anti-rat secondary with DAB reagent which followed counterstaining of nuclei using hematoxylin. This antibody specifically labelled the endothelial cells in blood vessels located primarily in the sub-mucosa, and of that of the mucosa muscularis and the mucosal lacteal.
Flow Cytometry: CD34 Antibody (MEC 14.7) [NB600-1071] - CD34 (MEC 14.7) antibody was tested at 1:250 in WEHI-3 cells with DyLight 488 (green) alongside a matched isotype control (black).
(19 Publications)
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
FANCB Antibody
(M38P3E10)
NBP2-52406
Immunohistochemistry-Paraffin: FANCB Antibody (M38P3E10) [NBP2-52406] - Staining was performed on formalin-fixed, paraffin-embedded human breast cancer tissue sections using anti-FANCB [M38P3E10]. The antibody shows both nuclear and cytoplasmic staining but it is predominately cytoplasmic.
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
GM-CSF
7954-GM/CF
GM-CSF
(1 Publication)
Species: Hu
RUNX1T1/ETO
Antibody
NBP2-55747
RUNX1T1/ETO Antibody
Species: Hu, Mu, Rt
Applications: WB, ICC/IF

Publications for RUNX1T1/ETO Antibody (NBP2-55747) (0)

There are no publications for RUNX1T1/ETO Antibody (NBP2-55747).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for RUNX1T1/ETO Antibody (NBP2-55747) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP2-55747:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot RUNX1T1/ETO NBP2-55747
Enlarge
reviewed by:
Karen McColl
 WB Human 02/07/2018
View

Summary

ApplicationWestern Blot
Sample TestedNon-small cell lung cancer
SpeciesHuman
LotR59770

Comments

CommentsTransferred in Caps Buffer for 2 hrs at 250mA. Used a 1:3000 primary antibody dilution and a 1:10,000 anti-rabbit secondary. Signal is very strong with a regular ECL solution.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RUNX1T1/ETO Antibody (NBP2-55747) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional RUNX1T1/ETO Products

Bioinformatics Tool for RUNX1T1/ETO Antibody (NBP2-55747)

Discover related pathways, diseases and genes to RUNX1T1/ETO Antibody (NBP2-55747). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RUNX1T1/ETO Antibody (NBP2-55747)

Discover more about diseases related to RUNX1T1/ETO Antibody (NBP2-55747).
 

Pathways for RUNX1T1/ETO Antibody (NBP2-55747)

View related products by pathway.

PTMs for RUNX1T1/ETO Antibody (NBP2-55747)

Learn more about PTMs related to RUNX1T1/ETO Antibody (NBP2-55747).

Blogs on RUNX1T1/ETO

There are no specific blogs for RUNX1T1/ETO, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0
Western Blot RUNX1T1/ETO NBP2-55747
Enlarge
 Karen McColl
02/07/2018
Application: WB
Species: Human
read this review

Bioinformatics

Gene Symbol RUNX1T1
COVID-19 update