RUNX1T1/ETO Antibody - BSA Free

Western Blot: RUNX1T1/ETO Antibody [NBP2-55747] - H2135 and H2087 non-small cell lung cancer cells showing baseline Runx1T1 expression versus Runx1T1 stable overexpression. Image submitted by a verified customer review.

Immunocytochemistry/Immunofluorescence: RUNX1T1/ETO Antibody [NBP2-55747] - Staining of human cell line HEK 293 shows localization to nucleoplasm. Antibody staining is shown in green.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RUNX1T1/ETO Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KGGGSSSSHSRQQSPVNPDPVALDAHREFLHRPASGYVPEEIWKKAE
• Predicted Species: Mouse (98%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RUNX1T1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot Validated from a verified customer review
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  RUNX1T1/ETO Recombinant Protein Antigen (NBP2-55747PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for RUNX1T1/ETO Antibody - BSA Free

• AML1T1protein CBFA2T1
• CBFA2T1Cyclin-D-related protein
• CDRMGC2796
• core-binding factor, runt domain, alpha subunit 2; translocated to, 1; cyclinD-related
• DKFZp564B213
• Eight twenty one protein
• ETOFLJ33145
• MTG8acute myelogenous leukemia 1 translocation 1, cyclin-D related
• Protein ETO
• Protein MTG8
• runt-related transcription factor 1; translocated to, 1 (cyclin D-related)
• Zinc finger MYND domain-containing protein 2
• ZMYND2myeloid translocation gene on 8q22

Background

RUNX1T1 / ETO is encoded by this gene is a putative zinc finger transcription factor and oncoprotein. In acute myeloid leukemia, especially in the M2 subtype, the t(8;21)(q22;q22) translocation is one of the most frequent karyotypic abnormalities. The translocation produces a chimeric gene made up of the 5'-region of the RUNX1 gene fused to the 3'-region of this gene. The chimeric protein is thought to associate with the nuclear corepressor/histone deacetylase complex to block hematopoietic differentiation. Several transcript variants encoding multiple isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RUNX1T1/ETO Antibody (NBP2-55747)(2)

Publications using NBP2-55747

• Tian He, Gary Wildey, Karen McColl, Alyssa Savadelis, Kyle Spainhower, Cassidy McColl, Adam Kresak, Aik Choon Tan, Michael Yang, Ata Abbas, Afshin Dowlati Identification of RUNX1T1 as a potential epigenetic modifier in small‐cell lung cancer Molecular Oncology 2020-11-27 [PMID: 33084222]
• He T Identification and clinical significance of two divergent regulators in thoracic malignancy: miR-18a and RUNX1T1 Thesis 2021-01-01 (WB, Human)

Review for RUNX1T1/ETO Antibody (NBP2-55747) (1)

Average Rating: 5

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Karen McColl WB Human 02/07/2018

Summary

• Application: Western Blot
• Sample Tested: Non-small cell lung cancer
• Species: Human
• Lot: R59770

Comments

• Comments: Transferred in Caps Buffer for 2 hrs at 250mA. Used a 1:3000 primary antibody dilution and a 1:10,000 anti-rabbit secondary. Signal is very strong with a regular ECL solution.

Bioinformatics

• Gene Symbol: RUNX1T1