Reactivity | Hu, Mu, RtSpecies Glossary |
Applications | WB, ICC/IF |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KGGGSSSSHSRQQSPVNPDPVALDAHREFLHRPASGYVPEEIWKKAE |
Predicted Species | Mouse (98%), Rat (96%). Backed by our 100% Guarantee. |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | RUNX1T1 |
Purity | Affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. RUNX1T1/ETO antibody validated for WB from a verified customer review. |
||
Control Peptide |
|
||
Reviewed Applications |
|
||
Publications |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Affinity purified |
Publication using NBP2-55747 | Applications | Species |
---|---|---|
He T Identification and clinical significance of two divergent regulators in thoracic malignancy: miR-18a and RUNX1T1 Thesis Jan 1 2021 (WB, Human) | WB | Human |
Images | Ratings | Applications | Species | Date | Details | ||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
![]() Enlarge |
reviewed by:
Verified Customer |
WB | Human | 02/07/2018 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
Diseases for RUNX1T1/ETO Antibody (NBP2-55747)Discover more about diseases related to RUNX1T1/ETO Antibody (NBP2-55747).
| Pathways for RUNX1T1/ETO Antibody (NBP2-55747)View related products by pathway.
|
PTMs for RUNX1T1/ETO Antibody (NBP2-55747)Learn more about PTMs related to RUNX1T1/ETO Antibody (NBP2-55747).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | RUNX1T1 |