CBFB Antibody

Images

 
Western Blot: CBFB Antibody [NBP1-87300] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunocytochemistry: CBFB Antibody [NBP1-87300] - Staining of human cell line U-2 OS shows positivity in cytoplasm.
Immunohistochemistry-Paraffin: CBFB Antibody [NBP1-87300] - Staining of human colon shows moderate membranous positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CBFB Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SKFENEEFFRKLSRECEIKYTGFRDRPHEERQARFQNACRDGRSEIAFVATGTNLSLQFFPASWQGEQRQTPSREYVDLEREAGKV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CBFB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CBFB Protein (NBP1-87300PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CBFB Antibody

  • CBFB
  • CBF-beta
  • core-binding factor subunit beta
  • core-binding factor, beta subunit
  • PEA2-beta
  • PEBP2B
  • PEBP2-beta
  • polyomavirus enhancer binding protein 2, beta subunit
  • Polyomavirus enhancer-binding protein 2 beta subunit
  • SL3/AKV core-binding factor beta subunit
  • SL3-3 enhancer factor 1 beta subunit
  • SL3-3 enhancer factor 1 subunit beta
  • SL3-3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89105
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92025
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00027130-P02
Species: Hu
21370002
Species: Hu
Applications: WB, ChIP, ELISA
H00010153-B01P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-02023
Species: Hu
Applications: WB, ICC/IF
NBP2-45545
Species: Hu
Applications: WB, IHC
AF5414
Species: Hu
Applications: WB, Simple Western
NBP1-19097
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NB100-59787
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-52406
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB600-248
Species: Hu
Applications: WB, IP
MAB17791
Species: Hu, Mu
Applications: WB
NBP2-49154
Species: Hu
Applications: IHC
NBP1-87300
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CBFB Antibody (NBP1-87300) (0)

There are no publications for CBFB Antibody (NBP1-87300).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CBFB Antibody (NBP1-87300) (0)

There are no reviews for CBFB Antibody (NBP1-87300). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CBFB Antibody (NBP1-87300) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CBFB Products

Bioinformatics Tool for CBFB Antibody (NBP1-87300)

Discover related pathways, diseases and genes to CBFB Antibody (NBP1-87300). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CBFB Antibody (NBP1-87300)

Discover more about diseases related to CBFB Antibody (NBP1-87300).
 

Pathways for CBFB Antibody (NBP1-87300)

View related products by pathway.

PTMs for CBFB Antibody (NBP1-87300)

Learn more about PTMs related to CBFB Antibody (NBP1-87300).

Blogs on CBFB

There are no specific blogs for CBFB, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CBFB Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CBFB
Entrez