RRM1 Antibody (4P4U1)

Western Blot: RRM1 Antibody (4P4U1) [NBP3-16364] - Western blot analysis of extracts of various cell lines, using RRM1 Rabbit mAb (NBP3-16364) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 5s.

Western Blot: RRM1 Antibody (4P4U1) [NBP3-16364] - Western blot analysis of extracts of Rat lung, using RRM1 Rabbit mAb (NBP3-16364) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.

• Reactivity: Hu, Mu, Rt
• Applications: WB
• Clone: 4P4U1
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

RRM1 Antibody (4P4U1) Summary

• Description: Novus Biologicals Rabbit RRM1 Antibody (4P4U1) (NBP3-16364) is a recombinant monoclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 691-792 of human RRM1 (P23921). VLKMAAERGAFIDQSQSLNIHIAEPNYGKLTSMHFYGWKQGLKTGMYYLRTRPAANPIQFTLNKEKLKDKEKVSKEEEEKERNTAAMVCSLENRDECLMCGS
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: RRM1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for RRM1 Antibody (4P4U1)

• EC 1.17.4.1
• R1
• ribonucleoside-diphosphate reductase large subunit
• Ribonucleoside-diphosphate reductase subunit M1
• Ribonucleotide reductase large subunit
• ribonucleotide reductase M1 polypeptide
• ribonucleotide reductase M1
• ribonucleotide reductase, large subunit
• ribonucleotide reductase, R1 subunit
• RIR1
• RR1
• RRM1

Background

RRM1 - ribonucleotide reductase M1 polypeptide

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RRM1