RPTOR Antibody (9N0A4) Summary
| Additional Information |
Recombinant Monoclonal Antibody |
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 1236-1335 of human RPTOR (Q8N122). VRIFDPRMPESVNVLQIVKGLTALDIHPQADLIACGSVNQFTAIYNSSGELINNIKYYDGFMGQRVGAISCLAFHPHWPHLAVGSNDYYISVYSVEKRVR |
| Source |
HEK293 |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Rabbit |
| Gene |
RPTOR |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA ,Recommended starting concentration is 1 μg/mL
- Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
- Immunohistochemistry 1:100 - 1:1000
- Immunohistochemistry-Paraffin 1:100 - 1:1000
- Simple Western 1:20 - 1:250
- Western Blot 1:500 - 1:2000
|
| Application Notes |
See Simple Western Antibody Database for Simple Western validation: Tested in Mouse brain lysate, separated by Size, antibody dilution of 1;20, 1:100, 1:250, apparent MW was 152 kDa |
| Theoretical MW |
149 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for RPTOR Antibody (9N0A4)
Background
Raptor (regulatory associated protein of TOR) is a conserved 150 kDa adaptor protein composed of a unique conserved region, three HEAT repeats and seven WD-40 repeats (1). Raptor recruits mTOR substrates S6K1 (p70 S6 kinase) and 4E-BP1, and regulates mTOR kinase activity (2-3). Even though Raptor is a positive regulator of mTOR, it has been shown that under nutrient deprivation, the Raptor-mTOR association is stabilized in a manner that inhibits mTOR kinase activity (1). Raptor association with mTOR is required for efficient S6K1 and 4E0BP1 phosphorylation (4).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Rt
Applications: ELISA, IHC, Â IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, Â IHC-P, IP, KD, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: IHC, Â IHC-P, KO, WB
Species: Hu, Mu
Applications: IHC, Â IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, Â IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, Â IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, Â IHC-P, IP, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, Â IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu, Rt
Applications: Flow, IHC, Â IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, Â IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ICC, KO, WB
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
Species: Hu, Mu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC, Â IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, Â IHC-P, WB
Species: Hu, Mu
Applications: WB, Simple Western, ELISA, ICC/IF, IHC
Publications for RPTOR Antibody (NBP3-16729) (0)
There are no publications for RPTOR Antibody (NBP3-16729).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for RPTOR Antibody (NBP3-16729) (0)
There are no reviews for RPTOR Antibody (NBP3-16729).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for RPTOR Antibody (NBP3-16729) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional RPTOR Products
Research Areas for RPTOR Antibody (NBP3-16729)
Find related products by research area.
|
Blogs on RPTOR