RPRD1B Antibody

Western Blot: RPRD1B Antibody [NBP1-55467] - Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

RPRD1B Antibody Summary

• Immunogen: Synthetic peptides corresponding to RPRD1B (regulation of nuclear pre-mRNA domain containing 1B) The peptide sequence was selected from the middle region of RPRD1B. Peptide sequence KKSLKRTFQQIQEEEDDDYPGSYSPQDPSAGPLLTEELIKALQDLENAAS. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RPRD1B
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Application Notes: This is a rabbit polyclonal antibody against C20orf77 and was validated on Western blot.
• Theoretical MW: 37 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RPRD1B Antibody

• Cell cycle-related and expression-elevated protein in tumor
• cell-cycle related and expression-elevated protein in tumor
• chromosome 20 open reading frame 77
• CREPTC20orf77
• dJ1057B20.2
• DKFZp434P0735
• FLJ44520
• NET60
• regulation of nuclear pre-mRNA domain containing 1B
• regulation of nuclear pre-mRNA domain-containing protein 1B

Background

The function of this protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RPRD1B
• Uniprot:
  • Q9NQG5(Human)