RPAP2 Antibody - BSA Free

Western Blot: RPAP2 Antibody [NBP2-13248] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue

Immunocytochemistry/Immunofluorescence: RPAP2 Antibody [NBP2-13248] - Staining of human cell line A-431 shows positivity in nucleoli and cytoplasm.

Immunohistochemistry-Paraffin: RPAP2 Antibody [NBP2-13248] - Staining of human Testis shows strong nuclear and cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: RPAP2 Antibody [NBP2-13248] - Staining of human Cerebellum shows strong nuclear and cytoplasmic positivity in Purkinje cells.

Immunohistochemistry-Paraffin: RPAP2 Antibody [NBP2-13248] - Staining of human Tonsil shows moderate nuclear and cytoplasmic positivity in squamous epithelial cells.

Staining of human Kidney shows moderate cytoplasmic positivity in cells in tubules.

ChIP-Exo-Seq composite graph for Anti-RPAP2 (NBP2-13248) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC, ChIP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RPAP2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: RCSRKAAGTKQTSTLKQEDASKRKAELEAAVRKKIEFERKALHIVEQLLEENITEEFLMECGRFITPAHYSDVVDERSIVKLCGYPLCQKKLGI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RPAP2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation-exo-Seq 1-10ug per reaction
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  RPAP2 Protein (NBP2-13248PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for RPAP2 Antibody - BSA Free

• C1orf82putative RNA polymerase II subunit B1 CTD phosphatase RPAP2
• chromosome 1 open reading frame 82
• EC 3.1.3.-
• FLJ13150
• RNA polymerase II associated protein 2
• RNA polymerase II-associated protein 2

Background

Forms an interface between the RNA polymerase II enzyme and chaperone/scaffolding protein, suggesting that itis required to connect RNA polymerase II to regulators of protein complex formation

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RPAP2