RPAP2 Antibody

Images

 
Western Blot: RPAP2 Antibody [NBP2-13248] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunocytochemistry/ Immunofluorescence: RPAP2 Antibody [NBP2-13248] - Staining of human cell line A-431 shows positivity in nucleoli and cytoplasm.
Immunohistochemistry-Paraffin: RPAP2 Antibody [NBP2-13248] - Staining of human duodenum shows moderate nuclear and cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RPAP2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RCSRKAAGTKQTSTLKQEDASKRKAELEAAVRKKIEFERKALHIVEQLLE ENITEEFLMECGRFITPAHYSDVVDERSIVKLCGYPLCQKKLGI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RPAP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RPAP2 Protein (NBP2-13248PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RPAP2 Antibody

  • C1orf82putative RNA polymerase II subunit B1 CTD phosphatase RPAP2
  • chromosome 1 open reading frame 82
  • EC 3.1.3.-
  • FLJ13150
  • RNA polymerase II associated protein 2
  • RNA polymerase II-associated protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24763
Species: Hu, Pm
Applications: WB, IHC-P
NBP1-77933
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB6240
Species: Hu
Applications: WB, IHC
NB100-61050
Species: Hu
Applications: WB, IHC-P, IP, PLA
NBP1-36999
Species: Hu, Mu, Rt
Applications: PEP-ELISA
NBP2-38621
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-30061
Species: Hu, Mu
Applications: WB, IP
NB100-55268
Species: Hu
Applications: WB, IP
NBP2-45378
Species: Hu
Applications: WB, IHC
NBP2-24614
Species: Hu, Mu, Rt, Op, Pm
Applications: WB
NBP1-87343
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NB200-598
Species: Hu, Mu, Ye, Pm(-)
Applications: WB, ChIP, ELISA, Flow, ICC/IF, IP, CyTOF-ready, Flow-IC
NBP2-57432
Species: Hu
Applications: WB, ICC/IF
NBP2-15895
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF1726
Species: Hu
Applications: WB, IHC, ICC

Publications for RPAP2 Antibody (NBP2-13248) (0)

There are no publications for RPAP2 Antibody (NBP2-13248).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPAP2 Antibody (NBP2-13248) (0)

There are no reviews for RPAP2 Antibody (NBP2-13248). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RPAP2 Antibody (NBP2-13248) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RPAP2 Products

Bioinformatics Tool for RPAP2 Antibody (NBP2-13248)

Discover related pathways, diseases and genes to RPAP2 Antibody (NBP2-13248). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPAP2 Antibody (NBP2-13248)

Discover more about diseases related to RPAP2 Antibody (NBP2-13248).
 

Pathways for RPAP2 Antibody (NBP2-13248)

View related products by pathway.

PTMs for RPAP2 Antibody (NBP2-13248)

Learn more about PTMs related to RPAP2 Antibody (NBP2-13248).

Blogs on RPAP2

There are no specific blogs for RPAP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RPAP2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RPAP2